BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f03r (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) riboso... 234 5e-62 At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S... 230 6e-61 At2g39320.1 68415.m04827 OTU-like cysteine protease family prote... 37 0.016 At4g40020.1 68417.m05666 hypothetical protein 33 0.15 At1g03080.1 68414.m00282 kinase interacting family protein simil... 33 0.15 At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR ... 32 0.35 At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / t... 31 0.82 At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / t... 31 0.82 At2g46670.1 68415.m05824 pseudo-response regulator, putative / t... 31 0.82 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 31 0.82 At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containi... 31 1.1 At4g33690.1 68417.m04785 expressed protein 30 1.4 At1g14480.1 68414.m01717 ankyrin repeat family protein contains ... 30 1.9 At1g17440.2 68414.m02133 transcription initiation factor IID (TF... 29 3.3 At1g17440.1 68414.m02132 transcription initiation factor IID (TF... 29 3.3 At5g22080.1 68418.m02571 DNAJ heat shock N-terminal domain-conta... 29 4.4 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 28 5.8 At1g73960.1 68414.m08565 expressed protein similar to TATA bindi... 28 5.8 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 28 7.6 At3g58330.1 68416.m06502 hypothetical protein 28 7.6 >At5g39740.1 68418.m04813 60S ribosomal protein L5 (RPL5B) ribosomal protein L5, rice Length = 301 Score = 234 bits (572), Expect = 5e-62 Identities = 113/236 (47%), Positives = 157/236 (66%) Frame = -2 Query: 750 RLIVRLSNKDVTCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXX 571 R +VR +NKD+ Q+ + I GD + +AY+HELP+YG+ VGLTNYAAAY TG Sbjct: 50 RFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRV 109 Query: 570 XXXXXXXXXXXXXXXXXXDEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDG 391 ++++VEP D+ FR LDVGL RTTTG RVFGA+KGA+DG Sbjct: 110 LKMLEMDDEYEGNVEATGEDFSVEPTDSRR-PFRALLDVGLIRTTTGNRVFGALKGALDG 168 Query: 390 GLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKL 211 GL++PHS KRF G+ E+K+ +AE+HR +I+G HV+ YM+ L +D+ + + FS YIK Sbjct: 169 GLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKK 228 Query: 210 GVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQK 43 GV A++IE +YKK H AIRA+P+HKK E K + KR+N +KLT ERKN++ ++ Sbjct: 229 GVEAESIEEMYKKVHAAIRAEPNHKKTE-KSAPKEHKRYNLKKLTYEERKNKLIER 283 >At3g25520.1 68416.m03173 60S ribosomal protein L5 similar to 60S ribosomal protein L5 GB:P49625 from [Oryza sativa] Length = 301 Score = 230 bits (563), Expect = 6e-61 Identities = 112/236 (47%), Positives = 156/236 (66%) Frame = -2 Query: 750 RLIVRLSNKDVTCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXX 571 R +VR +NKD+ Q+ + I GD + +AY+HELP+YG+ VGLTNYAAAY TG Sbjct: 50 RFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRV 109 Query: 570 XXXXXXXXXXXXXXXXXXDEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDG 391 ++++VEP D+ FR LDVGL RTTTG RVFGA+KGA+DG Sbjct: 110 LKMLEMDDEYEGNVEATGEDFSVEPTDSRR-PFRALLDVGLIRTTTGNRVFGALKGALDG 168 Query: 390 GLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKL 211 GL++PHS KRF G+ E+K+ +AE+HR +I+G HV+ YM+ L +D+ + + FS YIK Sbjct: 169 GLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKK 228 Query: 210 GVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQK 43 GV A++IE +YKK H AIRADP + KK +K + KR+N +KLT ERKN++ ++ Sbjct: 229 GVEAESIEELYKKVHAAIRADP-NPKKTVKPAPKQHKRYNLKKLTYEERKNKLIER 283 >At2g39320.1 68415.m04827 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 189 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 1/94 (1%) Frame = -2 Query: 318 VHRAHIFGLHVAE-YMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPS 142 +H +++ G+H Y ++ E+ S + ++KL + EA K+ E R D Sbjct: 87 IHMSYLAGIHFNSIYKKNKEKGSRSSSSSSSAVWMKLQRKKEN-EAKKKEEEEKERKDME 145 Query: 141 HKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 40 ++K+ K+ K+ + +K+K + + K K+KK Sbjct: 146 KEEKKKDKEDKKKDKEDKKKAKVQKEKKEKKEKK 179 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 33.5 bits (73), Expect = 0.15 Identities = 29/112 (25%), Positives = 54/112 (48%), Gaps = 2/112 (1%) Frame = -2 Query: 348 DAESKKFNAEVHRAHIFGLH--VAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYK 175 + E K N V +I L ++E ++E++ + S RQ S + + +E + K Sbjct: 343 EIERVKVNEAVANDNIKKLKKMLSEIEVAMEEEKQRSLNRQES------MPKEVVEVVEK 396 Query: 174 KAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRL 19 K E + + + K+ KK+S K+K+ + K E K + +Q +F KR+ Sbjct: 397 KIEEKEKKEEKKENKKEKKESKKEKKEHSEK---KEDKEKKEQTHQNFDKRM 445 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/116 (22%), Positives = 56/116 (48%), Gaps = 5/116 (4%) Frame = -2 Query: 336 KKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFK-RQFSKYIKLGVTA--DAIEAIYKKAH 166 KK + V + + GLH + S+++ E++ K ++ + + TA + +E + K Sbjct: 612 KKHQSMVEQVELVGLHPESFGSSVKELQEENSKLKEIRERESIEKTALIEKLEMMEKLVQ 671 Query: 165 EAIRADPSHKKKELKKDSV--KQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 4 + + + S + +++ K K + ++LAE K+ + +K I RLQ+ E Sbjct: 672 KNLLLENSISDLNAELETIRGKLKTLEEASMSLAEEKSGLHSEKDMLISRLQSATE 727 >At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 816 Score = 32.3 bits (70), Expect = 0.35 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -2 Query: 180 YKKAHEAIRADPSHKKKELKKDSVKQKRWNK-RKLTLAERKNRIKQKKASFIK 25 +++A + D K K+L + KRWN R+LTLA + ++++ ++F+K Sbjct: 60 HRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLK 112 >At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 351 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/62 (27%), Positives = 35/62 (56%) Frame = -2 Query: 192 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA 13 +EA + +E I S +K +++S ++RW++ + A K R+K+K F K+++ Sbjct: 264 VEAGSQSTNEGIAGQSSSTEKPKEEESA-KQRWSRSQREAALMKFRLKRKDRCFDKKVRY 322 Query: 12 QA 7 Q+ Sbjct: 323 QS 324 >At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 468 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/62 (27%), Positives = 35/62 (56%) Frame = -2 Query: 192 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA 13 +EA + +E I S +K +++S ++RW++ + A K R+K+K F K+++ Sbjct: 381 VEAGSQSTNEGIAGQSSSTEKPKEEESA-KQRWSRSQREAALMKFRLKRKDRCFDKKVRY 439 Query: 12 QA 7 Q+ Sbjct: 440 QS 441 >At2g46670.1 68415.m05824 pseudo-response regulator, putative / timing of CAB expression 1-like protein, putative similar to pseudo-response regulator 9 [Arabidopsis thaliana] GI:10281000, timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022 Length = 183 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/62 (27%), Positives = 35/62 (56%) Frame = -2 Query: 192 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA 13 +EA + +E I S +K +++S ++RW++ + A K R+K+K F K+++ Sbjct: 96 VEAGSQSTNEGIAGQSSSTEKPKEEESA-KQRWSRSQREAALMKFRLKRKDRCFDKKVRY 154 Query: 12 QA 7 Q+ Sbjct: 155 QS 156 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 31.1 bits (67), Expect = 0.82 Identities = 19/85 (22%), Positives = 40/85 (47%) Frame = -2 Query: 258 DDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKL 79 ++ ++ + + G+ + I ++ +KA E R K ++ K+ K+KR +K K Sbjct: 765 EESQEYRSIGDESVSQGLFEEYITSLQEKAKEKERKRDEEKVRKEKERDEKEKRKDKDKE 824 Query: 78 TLAERKNRIKQKKASFIKRLQAQAE 4 + + R K+K KR ++ E Sbjct: 825 RREKEREREKEKGKERSKREESDGE 849 >At5g60960.1 68418.m07647 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 521 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 156 RADPSHKKKELKK-DSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 22 R DP KK+ K+ DS +KR + T A +K R+KQ SF+K+ Sbjct: 468 RVDPRFMKKKTKEVDSNVKKRETLPEKT-ARKKKRLKQINMSFVKK 512 >At4g33690.1 68417.m04785 expressed protein Length = 281 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 189 EAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRK 82 E +YK+AH R HKKK KK K+K+ +++K Sbjct: 243 EEVYKRAH---RKRKEHKKKLSKKHKSKEKKRDRKK 275 >At1g14480.1 68414.m01717 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 412 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +2 Query: 2 ASA*ACSLLMKEAFFCLILFFLSANVSLRLFQRFCLTE--SFFNSFFLWDGSARMASWAF 175 A+A A S++MK+ FF L+ + +F FCL F +F + G+ S+A Sbjct: 293 ANANAGSVVMKQTFFILLWISNTVGFCCAVFYTFCLIPLGQLFTIWFFYIGTCLCISYA- 351 Query: 176 L*MASIA 196 L MA I+ Sbjct: 352 LAMAVIS 358 >At1g17440.2 68414.m02133 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 172 SP*SHPCGSIPQEERVKERLCQTEALEQTQANI 74 SP SHP S+ Q+ + ++ + QT+ L Q Q I Sbjct: 96 SPLSHPSSSLDQQTQTQQLVQQTQQLPQQQQQI 128 >At1g17440.1 68414.m02132 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 172 SP*SHPCGSIPQEERVKERLCQTEALEQTQANI 74 SP SHP S+ Q+ + ++ + QT+ L Q Q I Sbjct: 96 SPLSHPSSSLDQQTQTQQLVQQTQQLPQQQQQI 128 >At5g22080.1 68418.m02571 DNAJ heat shock N-terminal domain-containing protein similar to J-domain protein Jiv [Bos taurus] GI:15777193; contains Pfam profile PF00226 DnaJ domain Length = 246 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/67 (28%), Positives = 34/67 (50%) Frame = -2 Query: 234 QFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNR 55 +F K +KL V + +++ A+R S ++ LKKD +QK K+K E+ Sbjct: 143 EFQKELKLKVREILTDQEWRRRKMAMRI--SEEEGRLKKDEAEQKEIWKKKREHEEQWEG 200 Query: 54 IKQKKAS 34 ++K+ S Sbjct: 201 TREKRVS 207 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 28.3 bits (60), Expect = 5.8 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = -2 Query: 189 EAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKR--KLTLAERK--NRIKQKKASFIKR 22 E K+A+E+ + + KK E KK S ++ K + T ERK N +KKA ++ Sbjct: 747 EETQKEANESTKKERKRKKSESKKQSDGEEETQKEPSESTKKERKRKNPESKKKAEAVEE 806 Query: 21 LQAQAEA 1 + + E+ Sbjct: 807 EETRKES 813 >At1g73960.1 68414.m08565 expressed protein similar to TATA binding protein associated factor (GI:2827282) [Homo sapiens]; similar to Transcription initiation factor TFIID 150 kDa subunit (TAFII-150) (TAFII150) (Swiss-Prot:Q24325) [Drosophila melanogaster] Length = 1390 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -2 Query: 138 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 40 K+KE KKD K+++ KR+ + K R+K++K Sbjct: 1287 KEKEKKKDKEKKEKKRKREDPVYLEKKRLKKEK 1319 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 270 SLEQDD-EDSFKRQFSKYIK--LGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQK 100 S E DD ++S +R K K G+ + + K+ + + PS+KK+ K S +++ Sbjct: 821 SYEDDDHQNSLRRSKRKKHKKEAGIMTSSGRRVKKRNFDELEGAPSNKKRTRKSRSGRKE 880 Query: 99 RWNKRKLTLAERKNRIKQKKA 37 K + + R R + A Sbjct: 881 SKRKSSKSKSSRPRRAAARNA 901 >At3g58330.1 68416.m06502 hypothetical protein Length = 173 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 5/52 (9%) Frame = -2 Query: 156 RADPSHKKKELKKDS-VK----QKRWNKRKLTLAERKNRIKQKKASFIKRLQ 16 + D ++ KKE ++ S V+ +++ NKRKLTL++ ++ +K++KA+ + Q Sbjct: 116 KLDEAYLKKEKQRISGVRIRELEEQVNKRKLTLSDLESDLKKEKANQLSMAQ 167 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,680,264 Number of Sequences: 28952 Number of extensions: 309497 Number of successful extensions: 1108 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -