BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10f01r (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) 28 3.1 SB_52194| Best HMM Match : RVT_1 (HMM E-Value=0.94) 27 7.2 SB_40377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_33923| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_20452| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) 27 9.5 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) 27 9.5 SB_36735| Best HMM Match : Sin_N (HMM E-Value=0.082) 27 9.5 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +2 Query: 302 LKTRALLVELGSATSLVDTATTAVNTNKRANFILQNRSELKFRLKS 439 L TRA +V L +T+++ ATT V +K + ++ ELK +++S Sbjct: 625 LATRAPIVSLSKSTNIISKATTFVAVDKSTHEVIA-VPELKAQVES 669 >SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) Length = 334 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 266 RNSLSFEAIVPMLKTRALLVELGSATSLVDTATTAVNTNKRANFILQN 409 +N F+A +P L L +G+ SLV T +R+N++L N Sbjct: 15 KNEGVFKAAIPCLTVLGLWAIIGNTISLVVLLKTKSLRRRRSNYLLVN 62 >SB_52194| Best HMM Match : RVT_1 (HMM E-Value=0.94) Length = 472 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -2 Query: 178 HPSPASGSVTVRDCPRCGG-RCRL 110 H S S VR C +CGG RCR+ Sbjct: 422 HSSLKEDSTQVRGCEKCGGKRCRV 445 >SB_40377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 1 MLSFGWVDRSAEASPNLYIKVKS 69 +LS GW+D +A N+ KVKS Sbjct: 186 LLSIGWMDEAARRLANIVNKVKS 208 >SB_33923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 211 VYSTQQYA--HQGHPSPASGSVTV 146 +Y TQ YA H G P ASG +T+ Sbjct: 30 IYPTQSYAWLHNGKPLNASGRITI 53 >SB_20452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 28 SAEASPNLYIKVKSSAR*VYEPKSDGVPADTAPHNADSR 144 SA+ASP++ + + ++ P S +P+ AP N ++R Sbjct: 1020 SADASPSITLTRRRKVAELWRPVSLMLPSQLAPENGNAR 1058 >SB_58594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1001 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 152 DAPTCRTRMALMRILLGAVYLKSTICEVAVTPRVTEKLR-NSLSF 283 DA R + RILLG+VY ST C+ R+ E L+ N+ SF Sbjct: 836 DARPRRLPRKISRILLGSVY-HSTSCDEVENCRLLEHLQSNTESF 879 >SB_32724| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0029) Length = 302 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 152 DAPTCRTRMALMRILLGAVYLKSTICEVAVTPRVTEKLR-NSLSF 283 DA R + RILLG+VY ST C+ R+ E L+ N+ SF Sbjct: 104 DARPRRLPRKISRILLGSVY-HSTSCDEVENCRLLEHLQSNTESF 147 >SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 152 DAPTCRTRMALMRILLGAVYLKSTICEVAVTPRVTEKLR-NSLSF 283 DA R + RILLG+VY ST C+ R+ E L+ N+ SF Sbjct: 213 DARPRRLPRKISRILLGSVY-HSTSCDEVENCRLLEHLQSNTESF 256 >SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025) Length = 731 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 152 DAPTCRTRMALMRILLGAVYLKSTICEVAVTPRVTEKLR-NSLSF 283 DA R + RILLG+VY ST C+ R+ E L+ N+ SF Sbjct: 487 DARPRRLPRKISRILLGSVY-HSTSCDEVENCRLLEHLQSNTESF 530 >SB_36735| Best HMM Match : Sin_N (HMM E-Value=0.082) Length = 546 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 7 SFGWVDRSAEASPNLYIKVKSSAR*VYEPKSDGVPADTAPHNA 135 + G D EA NL V ++ + EP SD VPA H+A Sbjct: 60 AIGKDDGLQEACTNLKPNVHGTSVEIQEPCSDRVPASNPVHSA 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,674,002 Number of Sequences: 59808 Number of extensions: 283805 Number of successful extensions: 660 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -