BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e24r (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 26 4.2 SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cu... 26 4.2 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 26 5.6 SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc... 26 5.6 SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces p... 26 5.6 SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra... 25 9.7 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 507 PCSPGSSRQMAKSRPALSRLAPQLTGRSFTSAGSIM 400 P PG + MA R + +APQ TG G M Sbjct: 720 PQMPGMQQPMAPQRTGMQPMAPQRTGMQPQMTGGPM 755 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 507 PCSPGSSRQMAKSRPALSRLAPQLTG 430 P PG + MA R + +APQ TG Sbjct: 654 PQMPGMQQPMAPQRTGMQPMAPQRTG 679 >SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cuf1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 387 RLARSTRHTHVAITRLMAKKGA 322 R+AR TRH HV T KKG+ Sbjct: 47 RIARITRHLHVKCTCNSRKKGS 68 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -1 Query: 388 TPGKIHPSHACC---YYPFDGEERSSAEYEC 305 TP K P CC + P++ ++S+ +Y C Sbjct: 1226 TPLKFEPPDGCCPVCFCPYEKSKQSTEDYYC 1256 >SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 781 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 423 SFSPSAVEPASTAPGGTSPFVENCQANMDGTSTSNWSFRT 542 S S A AS PG + P V + N TS +W T Sbjct: 294 SLSSLASTGASYRPGPSKPLVSRVRDNYANTSYESWPHST 333 >SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 526 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 472 VPPGAVEAGSTADGEKLYFGRVN 404 VPP A+ A + DG +Y GR N Sbjct: 396 VPPWAMSACWSPDGNNIYIGRRN 418 >SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium transporting Cta4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1211 Score = 25.0 bits (52), Expect = 9.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 322 SSFLRHQTGNSNMRVTGGS 378 SS L+ Q+ SN+RV+GGS Sbjct: 588 SSALKRQSSVSNVRVSGGS 606 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,682,517 Number of Sequences: 5004 Number of extensions: 56352 Number of successful extensions: 151 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -