BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e20f (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor... 30 0.058 AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor... 30 0.077 AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor... 30 0.077 AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor... 30 0.077 AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor... 30 0.077 AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor... 30 0.077 AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor... 30 0.077 AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor... 30 0.077 AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor... 30 0.077 AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor... 30 0.077 AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 28 0.24 AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor... 28 0.24 AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor... 28 0.24 AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor... 28 0.24 AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor... 28 0.24 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 28 0.24 AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor... 28 0.24 AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor... 28 0.24 AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor... 28 0.24 AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor... 28 0.24 AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor... 28 0.24 AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor... 28 0.24 AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor... 28 0.24 AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor... 28 0.24 AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor... 28 0.24 AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor... 28 0.24 AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor... 28 0.24 AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor... 27 0.72 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 27 0.72 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 1.7 Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 25 2.2 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 25 2.2 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 25 2.2 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.2 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 2.9 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 3.8 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 5.1 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 6.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.9 >AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 30.3 bits (65), Expect = 0.058 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 535 LRLVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 + L + + YYDW TM + + +L+ T GA+L D L Sbjct: 69 MSLFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 111 >AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 71 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 111 >AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 29.9 bits (64), Expect = 0.077 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW TM + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTMGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 77 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 117 >AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 77 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 117 >AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 77 LFLYQLPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 117 >AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 77 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 117 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 76 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 116 >AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 76 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 116 >AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 68 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 108 >AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 79 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 119 >AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 82 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 122 >AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 82 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 122 >AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 74 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 114 >AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 28.3 bits (60), Expect = 0.24 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + YYDW T+ + + +L+ T GA+L D L Sbjct: 74 LFLYELPYYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 114 >AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 26.6 bits (56), Expect = 0.72 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + +YDW T+ + + +L+ T GA+L D L Sbjct: 68 LFLYELPFYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 108 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.72 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 541 LVIGKTTYYDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 L + + +YDW T+ + + +L+ T GA+L D L Sbjct: 80 LFLYELPFYDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +3 Query: 87 IQNLE-RFG--SLNKYYYYSNAQRNSITLT 167 IQN+E R+G S+ YYY +RN T+T Sbjct: 1258 IQNMEIRYGGTSVVLYYYKMGTERNCFTVT 1287 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 310 SPLVKNASLTIGLIVVVAVP 251 S LV A+L++ L+VVVA+P Sbjct: 3 SMLVAFATLSVALVVVVAIP 22 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 565 YDWEQTMLNTLKLFTPTDLVSXKTAGALLLDTL 663 YDW T+ + + +L+ T GA+L D L Sbjct: 88 YDWSTTIGYVVNMMFQVNLLVIGTIGAMLFDFL 120 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 310 SPLVKNASLTIGLIVVVAVP 251 S LV A+L++ L+VVVA+P Sbjct: 3 SMLVAFATLSVALVVVVAIP 22 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 108 GSLNKYYYYSNAQRNSITLTEDHF 179 GS + YYY N R ITL + ++ Sbjct: 323 GSGHLYYYEENGDRRKITLNDVYY 346 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 270 INPIVKDAFLTSGDYNVIVVDWSSFSLSTYSTAVM 374 +NPI+ SGD+N +W S S + AV+ Sbjct: 112 VNPII-----ISGDFNAWATEWGSKSTNARGNAVL 141 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +3 Query: 411 LKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARI 521 L+ +KL + K H ++ + + R EGK+ R+ Sbjct: 972 LEEMKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRL 1008 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 5.1 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -3 Query: 147 SVHCYSNNIYLNFQIAPSFEWHLRCKRQMQRPT 49 S++ YSN++Y+ F + + R+ + P+ Sbjct: 196 SIYSYSNHVYIRFAVGELLQRPAADSRRQEGPS 228 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 554 KQRTTTGNKRCSIR*SYSHRRIW 622 K R+ T RC +R + H+R W Sbjct: 446 KNRSLTEMGRCMLRDAGMHKRFW 468 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 8.9 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 3/81 (3%) Frame = +3 Query: 294 FLTSGDYNVIVVDWSS-FSLSTYSTAVMAVTG--VGSSIATFLKNLKLPLNKVHIVGFNL 464 +L +G+ V ++D F++ + V A G +G+S A N K IVG + Sbjct: 2669 YLYAGNSPVSLIDPDGQFAILLIVSIVTAAVGAYLGASAANKSWNPAKWEVKKAIVGATM 2728 Query: 465 GAHVAGVTGRNLEGKVARITG 527 GA V G + G + + G Sbjct: 2729 GAIVGGFAPVGIAGSITFLAG 2749 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,842 Number of Sequences: 2352 Number of extensions: 15719 Number of successful extensions: 76 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -