BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e16f (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55341| Best HMM Match : Mt_ATP-synt_B (HMM E-Value=0.0013) 51 7e-07 SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_34766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_31305| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) 29 3.3 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 29 4.4 SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22) 29 4.4 SB_25198| Best HMM Match : Tropomyosin (HMM E-Value=1.5e-08) 28 5.8 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 28 5.8 SB_40213| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.1e-07) 28 5.8 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 5.8 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) 28 7.6 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 7.6 SB_47139| Best HMM Match : Ion_trans_2 (HMM E-Value=0.62) 28 7.6 SB_44710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_11762| Best HMM Match : 4HBT (HMM E-Value=1.6e-19) 28 7.6 >SB_55341| Best HMM Match : Mt_ATP-synt_B (HMM E-Value=0.0013) Length = 185 Score = 51.2 bits (117), Expect = 7e-07 Identities = 30/83 (36%), Positives = 41/83 (49%) Frame = +3 Query: 261 GVTGPYTFGVGLATYLCSKEIYVMEHEYYSGLSLLVMVYVAHVKFGPKLAAWLDKEVEAT 440 G G F GLA YL S EI ++ E Y + Y K G +A LD + Sbjct: 69 GSLGQLMFFGGLAAYLLSNEILIIHEETYIAAVMGGTFYWLMKKAGGPIAEMLDNTSQEI 128 Query: 441 ENEWNEGRNQTVKALEDAIEGEK 509 + +N GRN ++K L+DAI+ EK Sbjct: 129 LDAFNVGRNASIKHLQDAIDNEK 151 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -1 Query: 341 FVLHYIDFLAAQVCCQTHTKSVRTRHTSFRVEELEPFFRNKAKSNFA 201 +VL+ IDF A C HT + H +F+VE F R KS F+ Sbjct: 21 YVLNSIDFEA----CDKHTIGIAYAHAAFKVEAATKFTREPLKSGFS 63 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 29.9 bits (64), Expect = 1.9 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 7/86 (8%) Frame = +3 Query: 417 LDKEVEATENEWNEGRNQTVKALEDAIEGEKTEQWRAQ--GQELLIQAKKENV-----LL 575 L++E+E+ + E E R + VKA E E+ EQ++A+ ++ IQA + + L Sbjct: 1543 LEEEIESKDAEAEEERTRIVKAAE-GFALEREEQFKAELADKDDCIQATENELNQVKHQL 1601 Query: 576 QLEAAYRERLMYAYSEVKRRLDYQLE 653 QL ++ L+ A E R L++ E Sbjct: 1602 QLAQEAKKTLLEASDERDRELEHLKE 1627 >SB_34766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 740 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/66 (22%), Positives = 29/66 (43%) Frame = +2 Query: 62 NNVVARGFAFRCEQTDRVHSTSRTGLRLRCSNTRPENLCSPCKG*ARQS*TWLYS*RMVP 241 + + G+ R + ++ G+R +C N ++C C+ R + T + +P Sbjct: 98 DQAIKEGYIHRGITCNTCQASPICGVRYKCGNCVDYDICERCESQDRHNSTHAFIKIRIP 157 Query: 242 ILPLEN 259 I PL N Sbjct: 158 IPPLAN 163 >SB_31305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 313 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 497 RGREDGAVARAGTGAPHPGQEGERAPAARG 586 RG E AGT A H G G APA G Sbjct: 204 RGYEQKTPESAGTSARHSGASGREAPAEAG 233 >SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) Length = 444 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 89 FRCEQTDRVHSTSRTGLRLRCSNTRPENLCS 181 +RC TD H T T +R T P+ LC+ Sbjct: 2 YRCHTTDCAHCTDFTRQTVRTVQTPPDRLCA 32 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 89 FRCEQTDRVHSTSRTGLRLRCSNTRPENLCS 181 +R QTD H T T LR T P+ LC+ Sbjct: 194 YRHHQTDCAHCTDFTRQTLRIVQTPPDRLCA 224 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 409 ANFGPNFT*ATYTMTSSDSPE*YS 338 ANFGP FT T+T TS D+ E +S Sbjct: 89 ANFGPGFT--TFTYTSGDARETFS 110 >SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22) Length = 350 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/73 (19%), Positives = 35/73 (47%) Frame = +3 Query: 384 HVKFGPKLAAWLDKEVEATENEWNEGRNQTVKALEDAIEGEKTEQWRAQGQELLIQAKKE 563 H + P+L W++ + + E + + + + +A E + E+ R Q +E + +E Sbjct: 61 HRECSPELKPWMEAQQKEMEEKLRLKKEEEERIQREAEEAAERERLRIQAEEEARRKAEE 120 Query: 564 NVLLQLEAAYRER 602 +++E R++ Sbjct: 121 EERIRIEEIKRQQ 133 >SB_25198| Best HMM Match : Tropomyosin (HMM E-Value=1.5e-08) Length = 277 Score = 28.3 bits (60), Expect = 5.8 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +3 Query: 417 LDKEVEATENEWNEGRNQTVKALEDAIEGEKTEQWRAQGQELLIQAKKENVLLQLEAAYR 596 L K +E T+ E +E + ALE+AIE +K+ + EL I+ + + +E R Sbjct: 90 LCKTLEVTDRESDEKMRELEDALEEAIELDKSTADKLAEVELKIKVVQGELEKAVERGDR 149 Query: 597 ERLM 608 +M Sbjct: 150 AEMM 153 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 524 RAGTGAPHPGQEGERAPAARGRLQGEAHVRLLRGEAASGL 643 R+ G PGQ+GE P+ GR G ++ + SG+ Sbjct: 429 RSTRGTALPGQDGEDRPSGEGRQSGGPGIQAVWEAGTSGV 468 >SB_40213| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.1e-07) Length = 750 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 489 DAIEGEKTEQWRAQGQELLIQAKKENVL 572 D + + +QW EL ++ KKENVL Sbjct: 238 DVVLADLDQQWMLDSAELCLEEKKENVL 265 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.3 bits (60), Expect = 5.8 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 2/112 (1%) Frame = +3 Query: 216 GFIPEEWFQFFHSKTGVTGPYTFGVGLATYLCSKEIYVMEHEYYSGLSLLVMVYVAHVKF 395 GF+ E++F SK+ +G+A+Y S I+ + Y +G + + Sbjct: 2183 GFLREKYFVIGISKSFEISANKTRIGVASYSSSANIHFNFNTYNTGYDVENAINAISFSG 2242 Query: 396 GPK--LAAWLDKEVEATENEWNEGRNQTVKALEDAIEGEKTEQWRAQGQELL 545 G K LA LD E N + + + + AL +G T++ Q L+ Sbjct: 2243 GAKRNLARGLDATFEGLFN-FTDIQPSDINALIVLTDGRATDEIDMAAQRLV 2293 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 524 RAGTGAPHPGQEGERAPAARGRLQGEAHVRLLRGEAASGL 643 R+ G PGQ+GE P+ GR G ++ + SG+ Sbjct: 1096 RSTRGTALPGQDGEDRPSGEGRQSGGPGIQAVWEAGTSGV 1135 >SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) Length = 524 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 47 IKYTINNVVARGFA-FRCEQTDRVHSTSRTGLRLRCSNTRPENLCS 181 I YT+ R A +R QTD H T T +R T P+ LC+ Sbjct: 14 IVYTVQTSPDRLCALYRHHQTDCAHCTVTTRQTVRTVQTPPDRLCA 59 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 420 DKEVEATENEWNEGRNQTVKALEDAIEGEKTEQWRAQGQELLIQAKKENVLLQ 578 +KEVE NE + + KALE A G+K E+ + + ++ +E LQ Sbjct: 2190 EKEVEMLSRV-NELQEELAKALESAEAGKKAEKQLKEQESEHVELSREKEALQ 2241 >SB_47139| Best HMM Match : Ion_trans_2 (HMM E-Value=0.62) Length = 116 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -3 Query: 150 HRRRSPVRLVLCT--RSVCSHLNAKPRATTLFIVYF 49 HRRR P ++L + R C+ +N+K AT L +Y+ Sbjct: 58 HRRRRPAAILLQSYWRMYCADINSKSVATWLPHIYY 93 >SB_44710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 835 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 287 TKSVRTRHTSFRVEELEPFFRNKAKSNFAWLTPYRASKGFLVVCCY 150 TK + H+ R + PFF ++ K + W T A+ G++V Y Sbjct: 149 TKEINNMHSELR--KSIPFFSSRYKGHGIWDTLMAANLGYMVAFMY 192 >SB_11762| Best HMM Match : 4HBT (HMM E-Value=1.6e-19) Length = 519 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +3 Query: 474 VKALEDAIEGEKTEQWRAQGQELLIQAKKENVLLQL--EAAYRERLMYAYSEVKRRL 638 V ++ED I GEK E R + AK V L ERL YA + +RR+ Sbjct: 91 VVSVEDLITGEKREVSRGFFTFVAFDAKHNKVQLSPIDPVTEEERLQYALASERRRM 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,058,949 Number of Sequences: 59808 Number of extensions: 457691 Number of successful extensions: 1526 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -