BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e16f (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 1.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 1.6 CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 23 6.4 AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 23 8.4 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.8 bits (54), Expect = 1.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -1 Query: 356 QSGVIFVLHYIDFLAAQVCCQTHTKSVRTRHTSFRV 249 +SG I VLH + L CC HT R+ V Sbjct: 575 RSGFILVLHGVPGLQQLCCCIRHTPPAIARNVGSSV 610 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 536 GAPH-PGQEGERAPAARGRLQGEAHVRLLRGE 628 GAP PG++GE+ R L G R L+GE Sbjct: 544 GAPGLPGRDGEKGEPGRPGLPGAKGERGLKGE 575 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 23.4 bits (48), Expect = 6.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 135 PVRLVLCTRSVCSHLNAKP 79 P +V CTR+VC+ N P Sbjct: 117 PSMIVKCTRNVCTGRNEVP 135 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 81 ALRSGASKQTACTALVARGSASDVA 155 AL G+S+QTA + + SDVA Sbjct: 363 ALMMGSSRQTAFVGRLVKPDQSDVA 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,884 Number of Sequences: 2352 Number of extensions: 14709 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -