BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e13r (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.88 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 24 1.5 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 4.7 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.88 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 395 STWQPSLDTNEVTPTCVIWPSSSITVRGPPLSPWQVD 505 +T +P+ + PT WP+ T+ P + +VD Sbjct: 1061 TTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEVD 1097 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.8 bits (49), Expect = 1.5 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = -2 Query: 452 AKSHK*ESLRSCPAKAATWIYLQVLSGPAT--TSTGLRRSPV*ISIGHRAQ 306 +++H S++S ++AA Y SG +T TSTGLRR+ + IG + Q Sbjct: 89 SRAHIHCSVKSESSQAAK--YGGCFSGESTVLTSTGLRRNLSSLQIGEKIQ 137 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 103 NTRDPRNQIPKLRHRFLNSNI 41 N+R+ RN+ K+R LNS I Sbjct: 28 NSREMRNRAEKMRRDKLNSYI 48 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 17 HQKVKLFLNITIQKAVPKFRYL 82 H K ++FLNIT K F ++ Sbjct: 316 HNKTEIFLNITGDKTNSVFEHV 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,154 Number of Sequences: 336 Number of extensions: 2735 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -