BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e13f (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0561 - 22183140-22183185,22183273-22183442,22183554-221836... 30 1.9 03_05_0382 + 23649597-23649645,23649675-23649735,23650784-236509... 28 5.7 >06_03_0561 - 22183140-22183185,22183273-22183442,22183554-22183619, 22183911-22184010,22184072-22184164,22184259-22184352, 22185029-22185257,22185460-22185556,22187406-22187710 Length = 399 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 368 RMIYVLSGLEKQAGTGQVHCSSSDDD 291 R+ Y GL+K G G+VH + SDDD Sbjct: 318 RLGYKSVGLDKGRGKGKVHATPSDDD 343 >03_05_0382 + 23649597-23649645,23649675-23649735,23650784-23650937, 23651019-23651149,23651239-23651315,23651439-23651477, 23651976-23652067,23652140-23652277,23652385-23652549 Length = 301 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 177 QLSIRMVSTVGGVNACGATIIHSNWGLTAAHCTGL 281 ++S + +VGGV + + + + WGL+ HC G+ Sbjct: 13 EISQGLPDSVGGVLSGPVSNVATRWGLSDLHCKGM 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,964,985 Number of Sequences: 37544 Number of extensions: 373278 Number of successful extensions: 1101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -