BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e10r (779 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82275-1|CAB05237.2| 472|Caenorhabditis elegans Hypothetical pr... 30 2.1 AF078157-16|AAG24082.1| 343|Caenorhabditis elegans Serpentine r... 28 8.6 >Z82275-1|CAB05237.2| 472|Caenorhabditis elegans Hypothetical protein K01G12.3 protein. Length = 472 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 57 YSFFYKQNSQSAS*FCQIICTLVS*YLRESYQGNYNFP 170 Y+ KQN Q + Q+I TL+ +R++Y N N P Sbjct: 332 YNSILKQNHQDDAVLFQVITTLLDQVIRQNYYLNLNIP 369 >AF078157-16|AAG24082.1| 343|Caenorhabditis elegans Serpentine receptor, class h protein89 protein. Length = 343 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 496 YIPYQIYLRLASRLTVGSSNRVAMWMRSGSLTSSEIKIS 380 Y PYQI++ +S L GSS RS + ++ KI+ Sbjct: 107 YAPYQIFIIYSSILCTGSSMIYLFESRSSGIPENKYKIT 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,399,120 Number of Sequences: 27780 Number of extensions: 284356 Number of successful extensions: 505 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -