BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e08r (741 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 7.9 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 21 7.9 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 21 7.9 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 21 7.9 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 450 MSFSEAPEILFWKD 491 + F + EILFWKD Sbjct: 1225 VEFLSSTEILFWKD 1238 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 450 MSFSEAPEILFWKD 491 + F + EILFWKD Sbjct: 1225 VEFLSSTEILFWKD 1238 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 450 MSFSEAPEILFWKD 491 + F + EILFWKD Sbjct: 1225 VEFLSSTEILFWKD 1238 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 450 MSFSEAPEILFWKD 491 + F + EILFWKD Sbjct: 1225 VEFLSSTEILFWKD 1238 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 7.9 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +2 Query: 566 QMVVRFPLVFECQTSVRHVIEVLEPLEE*DGDTTSVDVEVGDHENVAIDEDLVCSR 733 +M + FPL+ EC +R +E + EE D T V A + C R Sbjct: 138 KMKLMFPLMQECVDDLRRFLE--DHTEEIDVKTAMKKYSVDIISTCAFGINTYCFR 191 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 163 VVISLYCKMKEINIGLNLRSTLEFLRKYYTDNTLKLV 273 ++ISL C + + L L + LE Y+T L ++ Sbjct: 130 IIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHII 166 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 163 VVISLYCKMKEINIGLNLRSTLEFLRKYYTDNTLKLV 273 ++ISL C + + L L + LE Y+T L ++ Sbjct: 130 IIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHII 166 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 163 VVISLYCKMKEINIGLNLRSTLEFLRKYYTDNTLKLV 273 ++ISL C + + L L + LE Y+T L ++ Sbjct: 130 IIISLGCLILAVVFLLTLSALLEGFTLYHTTAYLHII 166 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 570 ICWNRSKSLSSGGSVA 523 + WN SLS GG +A Sbjct: 376 LSWNSISSLSHGGQLA 391 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,038 Number of Sequences: 336 Number of extensions: 3727 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -