BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e04r (744 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0FJI1 Cluster: Cytokine receptor family member B6; n=3... 33 9.8 >UniRef50_A0FJI1 Cluster: Cytokine receptor family member B6; n=3; Danio rerio|Rep: Cytokine receptor family member B6 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 316 Score = 32.7 bits (71), Expect = 9.8 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = +2 Query: 32 SIAFMHVEHNFVKNNNTHFLF*HTK-SHSS*KNETFKLLTSQREVFVHNYISSGMINLII 208 S+ H++ + K + H F + S +S +N ++ + ++ ++ N + SG I Sbjct: 126 SLTLAHMDQSLEKEHGEHLEFNISSWSVNSRENPEEDVVINSKD-YIFNDLESGQIYCFQ 184 Query: 209 IKF--YHKTYLHVHKNNCIFI 265 +++ YHK Y K C+FI Sbjct: 185 VEYLLYHKPYGKASKERCVFI 205 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,983,662 Number of Sequences: 1657284 Number of extensions: 13418711 Number of successful extensions: 26745 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26716 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -