BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10e04f (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 25 2.8 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 4.8 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 24.6 bits (51), Expect = 2.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 440 QHVQRLHFHPQLLYELQQL*IHQCEHQDLSW 348 +H + F+ + YE+ + H CE+ D +W Sbjct: 65 KHNMGMAFNRTMWYEIVRCARHFCEYDDYNW 95 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +2 Query: 542 SAEYGCKPIEGMLSHQLKQFRIDGEKSIIQNPSEAQR 652 S + +P+ GML Q +Q R ++++ + QR Sbjct: 60 SGTHSDRPVAGMLQQQQQQQRQPQRQAVVGTQQQQQR 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,319 Number of Sequences: 2352 Number of extensions: 12770 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -