BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d21r (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B... 25 8.7 >SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 Brl1|Schizosaccharomyces pombe|chr 3|||Manual Length = 692 Score = 25.4 bits (53), Expect = 8.7 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 4/80 (5%) Frame = +2 Query: 293 KHYDIRNMKTNTPLY-LCRNNMSRGERLFVLSDIIATLQESHLKFKIWKKYHITKKIFFS 469 KH ++ K L L + GE+L ++ + LQE H I Y+ + + Sbjct: 563 KHLQVKQTKLTQKLEDLIESVQKSGEKLMIMHQKLFHLQEEHTILSIKASYNKKESHLIN 622 Query: 470 Y---LNEVNLIKIQLKTSNC 520 E + K LK S C Sbjct: 623 QAYETQEAQVYKGMLKCSVC 642 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,938,993 Number of Sequences: 5004 Number of extensions: 58923 Number of successful extensions: 117 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -