BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d21r (747 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0535 - 23001864-23005052 32 0.42 12_02_0489 - 19619623-19619748,19619850-19620165,19620487-196207... 28 9.1 >01_05_0535 - 23001864-23005052 Length = 1062 Score = 32.3 bits (70), Expect = 0.42 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 145 ENENTKQLLRYSHNKIYYLHIIM*CSSGAPVRHDSAVTIC 264 E EN ++LLRY K+ ++ SSG P+R + +C Sbjct: 983 EEENKEELLRYHSEKLAVAFVLTRSSSGGPIRIMKNLRVC 1022 >12_02_0489 - 19619623-19619748,19619850-19620165,19620487-19620747, 19621320-19621710,19622242-19622254 Length = 368 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 556 VIKG-PFYLVSPSTVRCF*LNFN*VYFIQITEKDFF 452 ++KG P +L PS +RC+ F IQI+EK F Sbjct: 228 IVKGHPLFLDPPSKLRCYVNLFEWSELIQISEKTAF 263 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,429,257 Number of Sequences: 37544 Number of extensions: 314893 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -