BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d21f (633 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 28 0.21 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 28 0.21 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 28 0.21 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 4.6 AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 23 6.1 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 28.3 bits (60), Expect = 0.21 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 315 MILLVGQYSTGKTTFIRYLLERDFPGIRIGP 407 ++ ++G GKTT + L R PG++I P Sbjct: 128 LLAVMGSSGAGKTTLLNALAFRSPPGVKISP 158 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 28.3 bits (60), Expect = 0.21 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 315 MILLVGQYSTGKTTFIRYLLERDFPGIRIGP 407 ++ ++G GKTT + L R PG++I P Sbjct: 128 LLAVMGSSGAGKTTLLNALAFRSPPGVKISP 158 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 28.3 bits (60), Expect = 0.21 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 315 MILLVGQYSTGKTTFIRYLLERDFPGIRIGP 407 ++ ++G GKTT + L R PG++I P Sbjct: 106 LLAVMGSSGAGKTTLLNALAFRSPPGVKISP 136 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 19 YDGGGLLSLCGFVINLIQKWCS 84 YD GGL L ++I+ + W S Sbjct: 950 YDDGGLTLLLPYIISTRRNWAS 971 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 517 LLNGRNCFFGSTTNALPGITPSFSSNITAINLSVVGSGP 401 + GR+ F + A PG + + AIN + G+ P Sbjct: 79 VFGGRSMFQDKHSQAGPGTHAAHVVRVCAINAGLTGANP 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,643 Number of Sequences: 2352 Number of extensions: 13102 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -