BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d08r (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 2.0 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 3.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 6.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.2 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.4 bits (48), Expect = 2.0 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = -1 Query: 214 ETDCSIPCYVHSNRSKDLAGRNVESCFSLTVKQSKPAVLNVLGSVTIRLAF 62 ET + P Y S+ S+ NVE +L VK P V+G T F Sbjct: 288 ETGHNAPLYSPSSDSQYQKQLNVEHAANLWVKLGTPKEKLVIGMPTYGRTF 338 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 169 KDLAGRNVESCFSLTVKQSK-PAVLNVLGSVTIR 71 + L +N E CFSL +K K P L + V ++ Sbjct: 515 RTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVDLK 548 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 169 KDLAGRNVESCFSLTVKQS 113 +DLA RNV C + TVK S Sbjct: 616 RDLAARNVLVCENHTVKVS 634 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 381 RRSYIKARPRFGLATVDL 328 + SY+KA+ G+A VDL Sbjct: 398 KASYVKAKGLGGIAIVDL 415 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 Query: 625 SGIRNIQGHTITHFMKGQRXHTSVN 699 + +RN+Q HT ++ ++ H N Sbjct: 102 NSVRNVQQHTFADLIQLEQIHLDDN 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,720 Number of Sequences: 336 Number of extensions: 3541 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -