BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d08r (766 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708 31 1.3 02_02_0571 - 11664292-11664809,11664900-11665750,11665837-11666468 30 2.3 >07_03_1037 - 23438205-23441219,23443509-23444513,23444627-23446708 Length = 2033 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +3 Query: 69 SRIVTLPRTLSTAGLDCFTVRLKQDSTLRPAKSLLRF---E*T*HGMLQSVSNLTDNNHC 239 +R++ + RT+ +DCF RL+ + + S LRF + +L S S L DN + Sbjct: 1007 ARLLIMTRTVVFVAVDCFKNRLEFNPSEEAEHSYLRFADVKRQCRSVLTSASELADNAYR 1066 Query: 240 LLKIKIHL 263 + ++K L Sbjct: 1067 VKRVKREL 1074 >02_02_0571 - 11664292-11664809,11664900-11665750,11665837-11666468 Length = 666 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +3 Query: 195 GMLQSVSNLTDNNHCLLKIKIHLHRYFETLMEDLKSYYYT 314 G++Q+V LTD CL ++ + +E+L ED+KS+ T Sbjct: 443 GIIQAVGQLTDVKECLQTLR---NNGWESLFEDVKSFCAT 479 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,299,213 Number of Sequences: 37544 Number of extensions: 320201 Number of successful extensions: 713 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -