BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d08f (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52835| Best HMM Match : vATP-synt_E (HMM E-Value=2.1e-05) 51 8e-07 SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) 32 0.38 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_38984| Best HMM Match : Fork_head (HMM E-Value=3e-06) 30 1.5 SB_5418| Best HMM Match : Spectrin (HMM E-Value=1.50001e-40) 29 2.6 SB_57632| Best HMM Match : Fibrinogen_C (HMM E-Value=8) 29 2.6 SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_20174| Best HMM Match : DedA (HMM E-Value=3.7) 28 4.6 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 4.6 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_29067| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_52835| Best HMM Match : vATP-synt_E (HMM E-Value=2.1e-05) Length = 288 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/61 (40%), Positives = 38/61 (62%) Frame = +1 Query: 322 KVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALV 501 K E + +LDEA +RL +V +D Y +++ LI Q L+QL+E V IR R+ D +LV Sbjct: 68 KAEEIDAKRILDEAVERLGKVTQDQGKYQQIIQGLITQGLYQLLESKVLIRCRKQDVSLV 127 Query: 502 E 504 + Sbjct: 128 K 128 >SB_50642| Best HMM Match : Spectrin (HMM E-Value=1) Length = 739 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 307 RLKVLKVREDHVRNVLDEARKRLAEV 384 R+ LK +ED ++N+LDE R + EV Sbjct: 147 RINTLKTKEDEIKNILDEQRGKAEEV 172 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = -2 Query: 361 LHQVHYVRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHSIP*S*DVAAGQDGPFRC* 182 +HQVH VR +H + + L + + S+ P++PS S P + + P Sbjct: 618 VHQVHLVRLVHLAHLCTCTLSTPSTPSTPSTRSTPSTPSTPSTPSTPSTPSTPSTPSLTH 677 Query: 181 TPPRPS 164 TP PS Sbjct: 678 TPSTPS 683 >SB_38984| Best HMM Match : Fork_head (HMM E-Value=3e-06) Length = 246 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 485 PTRLWWSPCSEKLNKTTRIRSR 550 P R WWS SEKL K R++ R Sbjct: 214 PYRSWWSLASEKLRKERRMKPR 235 >SB_5418| Best HMM Match : Spectrin (HMM E-Value=1.50001e-40) Length = 514 Score = 29.1 bits (62), Expect = 2.6 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +1 Query: 334 DHVRNVLDEARKRLAEVPK-DTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALVESL 510 D V L+E R E+ T +L L+ FQL + + +RQTD L E L Sbjct: 164 DLVHAQLEEVNHRWDELCNHSTGRQQKLEEALLQLGQFQLAFQELLVWLRQTDSTLDEQL 223 Query: 511 LGKAQQDYK 537 K Q D K Sbjct: 224 AKKVQGDVK 232 >SB_57632| Best HMM Match : Fibrinogen_C (HMM E-Value=8) Length = 214 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = -2 Query: 352 VHYVRDLHALSVP-----SDELGSACSKIGSSSEVQPASPSFHSIP*S*DVAAGQDGP 194 ++Y++D H P + E G A + + S S A P F SIP D + +DGP Sbjct: 19 LYYLQDTHHNWYPVYCDFTSEAGKAWTLVLSFSYANHAKPEFFSIPFLDDGSLSEDGP 76 >SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2992 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 310 LKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLV 420 LK+LK R H RN EA+++ E ++TK++ ++ + Sbjct: 2941 LKILKERRMHARN---EAKRQAIEKERETKIHRKIAI 2974 >SB_20174| Best HMM Match : DedA (HMM E-Value=3.7) Length = 228 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/61 (19%), Positives = 27/61 (44%) Frame = -3 Query: 396 GVLWHFSQALASFIKYITYVIFTHFQYLQTSLVQHVRRXXXXXXXXXXXXLFIVFHNLET 217 G L H + + ++++T + H Q+L ++++ H+R V +L+ Sbjct: 55 GHLRHLTSTVIGHLQHLTSTVIGHLQHLTSTVIGHLRHLTSTVIGHLQHLTSTVIGHLQN 114 Query: 216 L 214 L Sbjct: 115 L 115 Score = 27.9 bits (59), Expect = 6.1 Identities = 7/36 (19%), Positives = 24/36 (66%) Frame = -3 Query: 393 VLWHFSQALASFIKYITYVIFTHFQYLQTSLVQHVR 286 V++ ++ + ++++T+ + H Q+L ++++ H+R Sbjct: 23 VIYTITRTVIGHLQHLTFTVIGHLQHLTSTVIGHLR 58 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 301 QARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSE 411 QA L+ + +D+++ D +KRLA++ + ++YS+ Sbjct: 2459 QAELEAARQSKDNLQEDFDNLQKRLAQLEAEQEIYSK 2495 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 352 LDEARKRLAEVPK-DTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQQ 528 L+E R E+ T +L L+ FQL + + +RQTD L E L K Q Sbjct: 5016 LEEVNHRWDELCNHSTGRQQKLEEALLQLGQFQLAFQELLVWLRQTDSTLDEQLAKKVQG 5075 Query: 529 DYK 537 D K Sbjct: 5076 DVK 5078 >SB_29067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 186 HRKGPSCPAATSQDYGIL*KEGEAG*TSEEDPIFEHAEPS 305 H K SC + D+ L GEAG TSE +P + +P+ Sbjct: 23 HWKSNSCKMDSDSDWDSL--SGEAGPTSEPEPTPRNLQPT 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,992,979 Number of Sequences: 59808 Number of extensions: 279045 Number of successful extensions: 857 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -