BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d08f (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 25 0.40 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.2 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 25.4 bits (53), Expect = 0.40 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +1 Query: 379 EVPKDTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDKALVESLLGKAQQDYKNKIKKDV 558 E+ K K E ++ +I +A +EPT +RQT + V +L A+ KK + Sbjct: 162 EIQKXIKKAKEDVIEVIQKAHNMELEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSL 221 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = -2 Query: 193 FRC*TPPRPSHRFLRP----FRWPL 131 FRC PP P RF+ P FR PL Sbjct: 148 FRCIGPPTPFPRFIPPNAYRFRPPL 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,834 Number of Sequences: 438 Number of extensions: 2167 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -