BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d07f (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_5796| Best HMM Match : RIO1 (HMM E-Value=0) 29 2.8 SB_57025| Best HMM Match : Fascin (HMM E-Value=0) 29 3.7 SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) 29 3.7 SB_20908| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) 28 6.4 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 28 6.4 SB_26289| Best HMM Match : TLD (HMM E-Value=0.08) 28 6.4 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 27 8.5 >SB_33542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 295 LCRSSDADSPDASTGRRREPHVDNPR 218 L R + A SP + R R PHVDN R Sbjct: 1079 LIRRARARSPHVDSARARSPHVDNTR 1104 >SB_5796| Best HMM Match : RIO1 (HMM E-Value=0) Length = 1329 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/94 (24%), Positives = 40/94 (42%) Frame = -3 Query: 537 KRQGSFEINTRIIN*KNGENEFFVQTKKQKLRVFACKRPEYAF*RPQICTVKRNPLRGAF 358 KR + N+ N N + FF Q ++ ++ F + + P + +N L+ A Sbjct: 102 KRLNASRTNSNASNPSNKQKTFF-QPHEKSIQRFGGRINVDKYHGPPLPNTAKNVLKEAN 160 Query: 357 TN*RFTKVKPTPPPVRRTLANCVDPRTRTALTRL 256 KV+ R T+ +DPRTR + +L Sbjct: 161 RKKDNEKVRSKDKADRATVEQVLDPRTRMIIFKL 194 >SB_57025| Best HMM Match : Fascin (HMM E-Value=0) Length = 504 Score = 28.7 bits (61), Expect = 3.7 Identities = 28/98 (28%), Positives = 41/98 (41%), Gaps = 1/98 (1%) Frame = -3 Query: 327 TPPPVRRTLANCVDPRTRTALTRL-PAGAVNLTLTTRELIVAARLTTKLRKSLSLEVILP 151 TPPP R L PRT T L P G +N+T++ AR + RKSL V + Sbjct: 172 TPPPWLRLLP-APYPRTPTTTCALVPVGTINITVSENN----ARSLRRKRKSLFCIVRVS 226 Query: 150 ILKALALSVDLGSATSLVDTATIAVNTNNRANFILQET 37 + S L + I + +N + ++ ET Sbjct: 227 KSNPFSRSSLLSEIMAEPSKWNIGLMNDNSSKYLTAET 264 >SB_40253| Best HMM Match : Spectrin (HMM E-Value=5.9e-16) Length = 1222 Score = 28.7 bits (61), Expect = 3.7 Identities = 7/26 (26%), Positives = 18/26 (69%) Frame = +3 Query: 369 EEDFALPYKFGDAKMHILDVYMQIHE 446 ++ F ++ +A H++D+Y+++HE Sbjct: 464 DDQFLKSPEYSEASSHVMDIYLEVHE 489 >SB_20908| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) Length = 576 Score = 27.9 bits (59), Expect = 6.4 Identities = 22/90 (24%), Positives = 40/90 (44%) Frame = -3 Query: 300 ANCVDPRTRTALTRLPAGAVNLTLTTRELIVAARLTTKLRKSLSLEVILPILKALALSVD 121 A V + T + A V+ ++T L VAA + +K ++ L V ++ +V+ Sbjct: 359 ATVVSKASSTVELGVAATVVSKAISTVGLGVAATVVSKAISTVGLGVAATVVFNAISTVE 418 Query: 120 LGSATSLVDTATIAVNTNNRANFILQETCT 31 LG A ++V A+ V A + + T Sbjct: 419 LGVAATVVSKASSTVELGVAATVVSKAIST 448 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 303 LANCVDPRTRTALTRLPAGAVNLTLTTRELIV-AARLTTKLRKSLS 169 L N V R L + P G +NL + TR+LI + L T R+++S Sbjct: 12 LTNLVRDCVREELRKNPGGNINLLMRTRQLIANSPLLGTASREAVS 57 >SB_26289| Best HMM Match : TLD (HMM E-Value=0.08) Length = 382 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 410 NAYSGR-LHANTRSFCFFVCTKNSFSP 487 N SGR +++RSF F +C KN + P Sbjct: 273 NTMSGRGYQSSSRSFLFTLCNKNGYRP 299 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 298 ELCRSSDADSPDASTGRRREPHVDNPRVN 212 +L S DSPD G R P +PR N Sbjct: 784 DLVTSRRTDSPDVDNGNRDSPPPTSPRAN 812 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,368,959 Number of Sequences: 59808 Number of extensions: 282588 Number of successful extensions: 821 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -