BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10d04r (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17335| Best HMM Match : Enolase_C (HMM E-Value=0) 147 9e-36 SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54101| Best HMM Match : MORN (HMM E-Value=2.8e-11) 28 6.8 SB_52915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) 28 6.8 >SB_17335| Best HMM Match : Enolase_C (HMM E-Value=0) Length = 284 Score = 147 bits (356), Expect = 9e-36 Identities = 75/104 (72%), Positives = 79/104 (75%) Frame = -2 Query: 619 MVSIEDPFDQDDWSAWANLTGRTPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIG 440 +VSIED FDQD W AW+ LTG IQIVG I TA+EKKACNCLLLKVNQIG Sbjct: 129 VVSIEDAFDQDHWDAWSKLTGNVDIQIVG----------IQTAIEKKACNCLLLKVNQIG 178 Query: 439 SVTESIDAHLLAKKNGWGTMVSHRSGETEDTFIADLVVGLSTGQ 308 SVTESI A LA+ NGWG MVSHRSGETEDTFIADLVVGL GQ Sbjct: 179 SVTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCAGQ 222 >SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 50.0 bits (114), Expect = 2e-06 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 14/147 (9%) Frame = -2 Query: 616 VSIEDPFDQDDWSAWANLTGRTPIQ--IVGDDLTVTNPKRIATAVEKKACNCLLLKVNQI 443 ++ D +DQD AW L R + ++G++L NP +AT V +K + LL + Sbjct: 233 IAANDFYDQDR-EAWTKLNQRIGEKCFVIGNELYRRNPSILATGVTEKLSSVALLSADNA 291 Query: 442 GSVTESIDAHLLAKKNGWGTMVSHRSGETEDTFIADLVV----------GLSTGQ--IKT 299 +VTE + G M+S E +T D V ++TG I+ Sbjct: 292 NTVTELWEKIRAVADQGGLVMLSKGQVEDVNTLAVDFVSTVVNTIPVANAVATGARFIRL 351 Query: 298 GAPCRSERLAKYNQILRIEEELGVNAK 218 G P R E + K+ +++ IE+ L N K Sbjct: 352 GGPARMEHVTKHRRMIEIEQILEQNGK 378 >SB_35743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 30.7 bits (66), Expect = 1.3 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 7/115 (6%) Frame = +2 Query: 200 EVLPGVFGVDAKFLFNAQNLVV--LGET--LRATRGAGLDLTRGQTNYQVGNKGIFGLTR 367 E+LPG+ G A F+F A V LGE L A + R Q++++ NKG R Sbjct: 235 ELLPGLVGSIANFVFKAAEEAVKFLGENAWLLILAVAAFLVRRMQSSHR--NKGALPPGR 292 Query: 368 SVRDHCA-PSVLLGQQVSIN*LCYAADLIDLQ*QTVA--CLLLNCSSDTLRVCHR 523 D P + G +S + LC D + + V L+ + D LRV H+ Sbjct: 293 HAVDPVLHPRMPTGHVMSTDWLCLGVDRVCAELHRVRGFLQLIVVADDALRVYHQ 347 >SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.1 bits (62), Expect = 3.9 Identities = 35/117 (29%), Positives = 52/117 (44%), Gaps = 9/117 (7%) Frame = +2 Query: 200 EVLPGVFGVDAKFLFNAQNLVV--LGET--LRATRGAGLDLTRGQTNYQVGNKGIFGL-- 361 E+LPG+ G A F+F A V LGE L A + R Q++++ N GI L Sbjct: 274 ELLPGLVGSIANFVFKAAGEAVKFLGENAWLLILAVAAFLVRRMQSSHR-NNCGILALPP 332 Query: 362 -TRSVRDHCAPSVLLGQQVSIN*LCYAADLIDLQ*QTVA--CLLLNCSSDTLRVCHR 523 +V P + G +S + LC D + + V L+ + D LRV H+ Sbjct: 333 GRHAVDPVLHPRMPTGHVMSTDWLCLGVDRVCAERHGVRGFLQLIVVAHDALRVYHQ 389 >SB_54101| Best HMM Match : MORN (HMM E-Value=2.8e-11) Length = 99 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 580 TNHPGQKDPQWTPWENL**SPNRHQLIYLMTGSRL--DWN 693 T HP ++P W W+ H +Y + G + +WN Sbjct: 4 TKHPKTREPLWKEWDYKAQKKGVHHTVYSVNGDQYTGEWN 43 >SB_52915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 580 TNHPGQKDPQWTPWENL**SPNRHQLIYLMTGSRL--DWN 693 T HP ++P W W+ H +Y + G + +WN Sbjct: 4 TKHPKTREPLWKEWDYKAQKKGVHHTVYSVNGDQYTGEWN 43 >SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) Length = 521 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -3 Query: 264 TTKFCALKRNLASTPNTPGRTSVDRSKNSLKKT 166 T++ +LKR+L ++P T RTS+ S+ + KT Sbjct: 111 TSRKTSLKRSLKTSPKTSRRTSLKTSQKTSPKT 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,888,114 Number of Sequences: 59808 Number of extensions: 479509 Number of successful extensions: 1308 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -