BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c24f (365 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 25 0.24 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 0.56 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 24 0.56 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 1.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 1.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.3 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 1.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 9.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 9.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 9.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 9.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 20 9.1 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 25.0 bits (52), Expect = 0.24 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 7/38 (18%) Frame = -1 Query: 113 CWATFLKIW-------LLARSKFLIPNILF*YNYSSKC 21 CWATF + W + S F++P ++ + Y+S C Sbjct: 190 CWATFQEPWGKRAYVTWYSISVFMVPLVVLIFTYTSIC 227 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.8 bits (49), Expect = 0.56 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 131 ITLMFLCWATFLKIWLL 81 +T CW++FLKI +L Sbjct: 544 VTYQLYCWSSFLKISVL 560 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 23.8 bits (49), Expect = 0.56 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 61 IRNLLRANNQIFKNVAQQRNMSVICTPPRNKVSR 162 +RNL + F+NVA+ R + + C N + R Sbjct: 207 LRNLDKIVTNGFRNVAESRKIFIECIEQYNVILR 240 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.6 bits (46), Expect = 1.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A +K + KKY Sbjct: 228 PGCFSLFRGKALMDKSVMKKY 248 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 1.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A +K + KKY Sbjct: 542 PGCFSLFRGKALMDKSVMKKY 562 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 1.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A +K + KKY Sbjct: 775 PGCFSLFRGKALMDKSVMKKY 795 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 1.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A +K + KKY Sbjct: 775 PGCFSLFRGKALMDKSVMKKY 795 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 22.6 bits (46), Expect = 1.3 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 149 FLGGVQITLMFLCWATFLKIW 87 F G +Q ++ W T +K W Sbjct: 126 FFGSIQFIIISKHWVTIMKEW 146 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A + + KKY Sbjct: 802 PGCFSLFRGKALMDDNVMKKY 822 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A + + KKY Sbjct: 802 PGCFSLFRGKALMDDNVMKKY 822 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A + + KKY Sbjct: 802 PGCFSLFRGKALMDDNVMKKY 822 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 218 PGCWSISSITATSNKIITKKY 280 PGC+S+ A + + KKY Sbjct: 802 PGCFSLFRGKALMDDNVMKKY 822 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 19.8 bits (39), Expect = 9.1 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -3 Query: 198 HHHQAGEEDH 169 HHH AG H Sbjct: 322 HHHHAGHHIH 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,060 Number of Sequences: 336 Number of extensions: 1575 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7510735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -