BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c24f (365 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0808 + 11412981-11413259 29 1.5 08_01_0034 - 253972-254916 27 3.4 06_01_1160 - 9868340-9868360,9868639-9868986 27 4.5 03_06_0084 + 31536286-31536718,31536907-31536983,31537380-315374... 27 4.5 03_05_0733 - 27241021-27241767 26 7.9 01_05_0168 - 18865821-18866843 26 7.9 >03_02_0808 + 11412981-11413259 Length = 92 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 61 IRNLLRAN-NQIFKNVAQQRNMSVICTPPRNKVSRG 165 +R +LR N + +F QQR M + PPR K G Sbjct: 50 VRKVLRENQDMVFIQQPQQREMGGLIMPPRGKTKLG 85 >08_01_0034 - 253972-254916 Length = 314 Score = 27.5 bits (58), Expect = 3.4 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 201 AHHHQAGEEDHLTSGNLVSWRSADNAHVPLLGDILKDLVVSAK*ISN 61 AH E HL G L S A + L D+ D+V K +S+ Sbjct: 263 AHREDMAERAHLVKGCLAMLSSGAEAVIAELDDLFDDIVEGRKMLSD 309 >06_01_1160 - 9868340-9868360,9868639-9868986 Length = 122 Score = 27.1 bits (57), Expect = 4.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 76 RANNQIFKNVAQQRNMSVICTPPRNK 153 +A Q+ + A RNM VICT P K Sbjct: 84 QAGRQVGRRPASIRNMRVICTTPNYK 109 >03_06_0084 + 31536286-31536718,31536907-31536983,31537380-31537428, 31537778-31538048,31540876-31541104,31541511-31541750 Length = 432 Score = 27.1 bits (57), Expect = 4.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 192 HQAGEEDHLTSGNL 151 HQ EEDHL +GNL Sbjct: 352 HQGAEEDHLITGNL 365 >03_05_0733 - 27241021-27241767 Length = 248 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 252 VAVMLDIDQHPGWDGRPAHHHQAGEEDHLTSGNLVS 145 +AV D+ G+ R H H DHL G+LV+ Sbjct: 56 LAVRPDVFSVAGFANRTGHWHALRGNDHLFRGDLVA 91 >01_05_0168 - 18865821-18866843 Length = 340 Score = 26.2 bits (55), Expect = 7.9 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 184 GLMVVGWSAIPAWVL-VNIKHYRDK 255 G+ + GW+ +P W L + + HY K Sbjct: 161 GITMKGWAVVPRWKLRLRVSHYLRK 185 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,332,578 Number of Sequences: 37544 Number of extensions: 159882 Number of successful extensions: 381 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -