BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c22f (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_56862| Best HMM Match : TPR_2 (HMM E-Value=1.4e-22) 30 0.63 SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) 29 1.9 SB_3105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) 27 4.5 SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) 27 4.5 SB_35891| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=1.9) 27 4.5 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 27 5.9 SB_10900| Best HMM Match : I-set (HMM E-Value=0) 27 5.9 SB_58258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) 27 7.8 SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73) 27 7.8 >SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.8 bits (111), Expect = 2e-06 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 2/84 (2%) Frame = +1 Query: 67 LDEQFKQVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPS--GLVESAKWKAWNG 240 + + F Q D VR+ K D++ L Y L+KQAT G ++P +V AKW++W+ Sbjct: 13 VQDLFAQATDYVRSLKNL-RDEQKLLFYGLFKQATEGPCKTSRPGFWDIVGKAKWESWHQ 71 Query: 241 RKGISQDDAKKQYIENAEKLHSKY 312 + Q+ A K Y++ L ++ Sbjct: 72 HGKMPQEKAMKIYVQELFSLDPEW 95 >SB_56862| Best HMM Match : TPR_2 (HMM E-Value=1.4e-22) Length = 300 Score = 30.3 bits (65), Expect = 0.63 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = -3 Query: 302 WSFSAFSMYCFLASSWEM---PLRPFHAFHLALSTRPLGWAMLTSPMVACLYREYSARF 135 WS F ++CFL W M PL P HL + + + S M+ C+Y E F Sbjct: 22 WS-KLFDIFCFLIM-WGMTMSPLTPDQQIHLLKVCYDISYLLGDSTMMMCVYLEAGGTF 78 >SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0) Length = 695 Score = 28.7 bits (61), Expect = 1.9 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +2 Query: 80 SNRSPIRLGTGRPSPVTMRTLRCTPCTSRLP*VMLTLPSP-AVLWRAPSGRHGTVAKASP 256 S+RS + P P+ R + + T P +++T SP A R+PS K SP Sbjct: 289 SSRSDSGDYSAAPPPLPERRMLNSTNTPTSPTLIVTHASPFASPGRSPSNSPRPSPKNSP 348 Query: 257 KTMPRSN 277 +T PRS+ Sbjct: 349 RTSPRSS 355 >SB_3105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 27.9 bits (59), Expect = 3.4 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 310 IWSGVSPH-FRCIASWHRLGRCLCDRSMPSTWRSPQDRWAGQC 185 +W G FR + RLGRC + R D W G+C Sbjct: 446 LWCGYEKSAFRICDTKIRLGRCALSEQLDPARRVYWDTWRGKC 488 >SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 191 PSPAVLWRAPSGRHGTVAKASPKTMPR 271 P P +AP+ R GT ASP T P+ Sbjct: 207 PEPVPTPKAPASRPGTKRPASPSTPPK 233 >SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) Length = 153 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 50 DNTKCLSTSNSNRSPIRLGTG-RPSPVTMRTLRCTPCTSR 166 DN CL T+ S+ + + GTG RP+ T+ T P +R Sbjct: 78 DNGLCLPTTASSSAAVPAGTGARPAIFTLATPNRRPTETR 117 >SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) Length = 618 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 191 PSPAVLWRAPSGRHGTVAKASPKTMPR 271 P P +AP+ R GT ASP T P+ Sbjct: 31 PEPVPTPKAPASRPGTKRPASPSTPPK 57 >SB_35891| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=1.9) Length = 138 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/64 (23%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -3 Query: 341 FI*F*VIIYAYLEWSFSAFSMYCFLASSWEMPLRPFHAFHLALSTRPLGWA-MLTSPMVA 165 F F V++Y Y+ W F+ + L + +P+ P + L + + W+ ++ + Sbjct: 34 FFVFRVLVYPYMYWRFAVYKNISLLEVPFNIPI-PCNVACFMLMSLQVNWSFVIIKGCLR 92 Query: 164 CLYR 153 LYR Sbjct: 93 YLYR 96 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.1 bits (57), Expect = 5.9 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Frame = +1 Query: 85 QVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPS-GLVESAKWKAWNGR-KGISQ 258 Q+ D + K K S ++ L S + QAT+GD + + G +E + G GI+ Sbjct: 121 QMKDLLSRGKVKVSLQKHALLDSYFAQATLGDYDTDKHGLGYLEDLLGSTFFGHPSGINS 180 Query: 259 --DDAKKQYIENAEKLH 303 D ++ Y++ LH Sbjct: 181 NIDVSETSYVQTVTMLH 197 >SB_10900| Best HMM Match : I-set (HMM E-Value=0) Length = 1642 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +2 Query: 191 PSPAVLWRAPSGRHGTVAKASPKTMPRSNTSKMRRNSTPNTH 316 P+P+V W PSG TV + + +N + + N+T + + Sbjct: 328 PTPSVSWILPSGAIATVTSPASRVQVLANHTLVIGNATESEY 369 >SB_58258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 751 Score = 27.1 bits (57), Expect = 5.9 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +1 Query: 22 ATTLPPDLKR*HKMSLDEQFKQVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPS 201 A+T P ++ + VA + ++K SD+ +L L +A++GD ++A P Sbjct: 280 ASTQRPSTPDIMSPTIGRRLSIVAHGQQRRRSKISDELSLVASLLIHEASVGDDDVALPE 339 Query: 202 GLVESAKWKAWN 237 + S K+WN Sbjct: 340 -VSLSDVMKSWN 350 >SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) Length = 809 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 221 SGRHGTVAKASPKTMPRSNTSKMRRNSTPNTHK 319 SG V K +++P+ TSK + TP+ H+ Sbjct: 564 SGNGKAVEKPREESIPQQTTSKRDESKTPSQHR 596 >SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73) Length = 895 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 47 KDNTKCLSTSNSNRSPIRLGTGRPSPVTMRTLRCTPCTSR 166 KD T ++ S S R+ + L GRP + +T T C S+ Sbjct: 64 KDLTNSIA-SGSERNSLHLQPGRPFRINTKTWPSTHCASK 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,874,787 Number of Sequences: 59808 Number of extensions: 300179 Number of successful extensions: 1062 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -