BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c21r (640 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK127728-1|BAC87104.1| 639|Homo sapiens lucosaminyltransferase ... 30 8.0 AK056514-1|BAB71201.1| 579|Homo sapiens protein ( Homo sapiens ... 30 8.0 >AK127728-1|BAC87104.1| 639|Homo sapiens lucosaminyltransferase IV-homolog (HGNT-IV-H). protein. Length = 639 Score = 29.9 bits (64), Expect = 8.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 361 LYHAVLLQLKIFPRPPKRCDATPRVSWKDRS 453 L H LQ +FP PP + TP WK+ S Sbjct: 129 LEHKADLQQHLFPVPPGHLECTPESLWKELS 159 >AK056514-1|BAB71201.1| 579|Homo sapiens protein ( Homo sapiens cDNA FLJ31952 fis, clone NT2RP7007221, weakly similar to Rattus norvegicus schlafen-4 (SLFN-4) mRNA. ). Length = 579 Score = 29.9 bits (64), Expect = 8.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 361 LYHAVLLQLKIFPRPPKRCDATPRVSWKDRS 453 L H LQ +FP PP + TP WK+ S Sbjct: 69 LEHKADLQQHLFPVPPGHLECTPESLWKELS 99 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,844,893 Number of Sequences: 237096 Number of extensions: 1827538 Number of successful extensions: 3368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3368 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7028963750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -