BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c21f (629 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4FLJ4 Cluster: Galactofuranosyl transferase; n=6; Acti... 34 3.2 UniRef50_Q72KK4 Cluster: Hypothetical conserved protein; n=7; Th... 33 7.5 UniRef50_A6G607 Cluster: Nicotinate phosphoribosyltransferase re... 33 7.5 UniRef50_Q55GS8 Cluster: Diaminopimelate epimerase; n=2; Dictyos... 32 9.9 >UniRef50_A4FLJ4 Cluster: Galactofuranosyl transferase; n=6; Actinomycetales|Rep: Galactofuranosyl transferase - Saccharopolyspora erythraea (strain NRRL 23338) Length = 657 Score = 33.9 bits (74), Expect = 3.2 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 167 TVSWFAARSIFPAHAWSRVTTLRRSRENLQLEQYGVIQ-KRDRLSGG 304 TVS+ A + FPA W R TT+ R NL LE G + R R GG Sbjct: 83 TVSFSAYFNAFPAGYWRRWTTITAIRLNLMLEGPGRVDVYRSRADGG 129 >UniRef50_Q72KK4 Cluster: Hypothetical conserved protein; n=7; Thermus thermophilus|Rep: Hypothetical conserved protein - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) Length = 315 Score = 32.7 bits (71), Expect = 7.5 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 7/56 (12%) Frame = +2 Query: 155 QGILTVSWFAARSIFP---AHAWSRVTTLRRSR--ENLQLEQYGVIQ--KRDRLSG 301 +G+L +W+AAR + H W VT LR +R + +QL ++G + K RL G Sbjct: 147 EGVLFDAWYAARQVLEWLHVHGWPFVTRLRSNRVLDGVQLRRHGGTRWVKTGRLRG 202 >UniRef50_A6G607 Cluster: Nicotinate phosphoribosyltransferase related protein; n=1; Plesiocystis pacifica SIR-1|Rep: Nicotinate phosphoribosyltransferase related protein - Plesiocystis pacifica SIR-1 Length = 510 Score = 32.7 bits (71), Expect = 7.5 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = -1 Query: 278 VSRRTAPTEDFPATAEAL*RDSTRELER*IWQRTMKLSRSPVQLRHEAILQPRRISNA 105 V R A D PA + R R W+R +KLS +P++ ILQ RR+ +A Sbjct: 332 VGTRLATAYDQPALGGVYKLSALRPDARAPWRRMVKLSSTPIKTSTPGILQVRRMRDA 389 >UniRef50_Q55GS8 Cluster: Diaminopimelate epimerase; n=2; Dictyostelium discoideum|Rep: Diaminopimelate epimerase - Dictyostelium discoideum AX4 Length = 514 Score = 32.3 bits (70), Expect = 9.9 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = -2 Query: 172 NCQDPLSNSDMKPFCSRDEYRTPDDVGWPAMKFQFVTNCTLSLVPQSIVITVH 14 N Q+P N D+KPF SR+ +T + + + + ++ T++ + Q + I H Sbjct: 228 NNQEPHHNEDLKPFFSRNRLKTLNQTPYLLFESRSISIYTIAGIQQCMTIPQH 280 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,921,247 Number of Sequences: 1657284 Number of extensions: 11886142 Number of successful extensions: 27174 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27171 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -