BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c21f (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 5.4 >SB_5695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 31.1 bits (67), Expect = 0.77 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +3 Query: 396 HDRRHRLPE--QTRNKLIREDVNIED--CRGYFFTTKFVCLFKCR 518 H+R+ L + Q R +L R VN E CR F+ +K VCL C+ Sbjct: 481 HNRQKALAQADQDRYRLFRNCVNRERNVCRAKFYNSKVVCLKDCK 525 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 103 QAFDIRLGCRMASCLSWTGDLDSFMVRCQIY--LSSSRVESR 222 +A ++ A L W GD++ ++ R + Y L +R ESR Sbjct: 98 RAIHVKASAMRAKRLLWVGDIEGYIERLECYFELMKTRTESR 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,474,394 Number of Sequences: 59808 Number of extensions: 378207 Number of successful extensions: 905 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -