BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c20f (411 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1539.06 |||acyl-coenzyme A binding protein |Schizosaccharomy... 71 5e-14 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 27 1.5 SPBC1683.08 |ght4||hexose transporter Ght4 |Schizosaccharomyces ... 26 2.0 SPCC1450.08c |wtf16||wtf element Wtf16|Schizosaccharomyces pombe... 26 2.0 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 26 2.6 SPBC13A2.02 |||nucleoporin Nup82|Schizosaccharomyces pombe|chr 2... 26 2.6 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 25 3.5 SPBC21H7.03c |||acid phosphatase |Schizosaccharomyces pombe|chr ... 25 3.5 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 25 3.5 SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2||... 25 4.6 SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 25 4.6 SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces po... 25 6.1 SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||... 25 6.1 SPAC4G8.04 |||GTPase activating protein |Schizosaccharomyces pom... 24 8.0 SPAC1F8.01 |ght3||hexose transporter Ght3 |Schizosaccharomyces p... 24 8.0 SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc... 24 8.0 >SPBC1539.06 |||acyl-coenzyme A binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 87 Score = 71.3 bits (167), Expect = 5e-14 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 3/85 (3%) Frame = +3 Query: 69 LDEQFKQVADKVRNWKTKPSDDENLALYSLYKQATIGDVNIAQPSGLVE---SAKWKAWN 239 + F+Q A V+ K P+ DE L LY+L+KQAT+GD N +P GL++ KW AW Sbjct: 1 MSSTFEQAAADVKELKETPNSDELLKLYALFKQATVGDNNTEKP-GLLDLKGKFKWNAWE 59 Query: 240 GRKGISQDDAKKQYIENAEKLHSKY 314 KG S++DA +YI ++L +KY Sbjct: 60 ELKGKSKEDAASEYISFVDELKTKY 84 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 26.6 bits (56), Expect = 1.5 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 322 IYAYLEWSFSAFS-MYCFLASSWEMP 248 ++ +L W + + +YCF SSW+ P Sbjct: 4043 LFFFLSWLHATLAEIYCFTCSSWKEP 4068 >SPBC1683.08 |ght4||hexose transporter Ght4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 557 Score = 26.2 bits (55), Expect = 2.0 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 193 AMLTSPMVACLYREYSARFSSSLGLVFQFLTLSA 92 AML+SP + ++YS F S ++ Q L ++A Sbjct: 73 AMLSSPFTEAIGKKYSIAFFSGCYIIGQILLVTA 106 >SPCC1450.08c |wtf16||wtf element Wtf16|Schizosaccharomyces pombe|chr 3|||Manual Length = 349 Score = 26.2 bits (55), Expect = 2.0 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 Query: 220 PSGRHGTVAKASPKTMPRSNTSKMRRNSTPNTHKLLLRIK*ISYLN 357 P H V+ SP T +N S+ NS+P KLL+ I LN Sbjct: 44 PYSDHARVSN-SPNTHRENNPSRSTDNSSPFLIKLLISFTPIYVLN 88 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 25.8 bits (54), Expect = 2.6 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 7/93 (7%) Frame = +1 Query: 67 LSTSNSNRSPIRLGTGRPSPVTMRTLRCTPCTSRLP*VMLTLPSPAVLWRAPSG------ 228 +S +++N SP R +P T+ L P P + +P+ +P Sbjct: 385 VSRNSNNNSPEGYDNNRTNP-TVNNLPSYPTNLARPKAIKPMPTSIHGQTSPLSPIPPVH 443 Query: 229 -RHGTVAKASPKTMPRSNTSKMRRNSTPNTHKL 324 HG V+ P +P ++ MR +STP +H L Sbjct: 444 TTHGLVSDIRP--LPSVSSPIMRADSTPISHNL 474 >SPBC13A2.02 |||nucleoporin Nup82|Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.8 bits (54), Expect = 2.6 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 105 RNWKTKPSDDENLALYSLYKQATIGDVNIAQPSG 206 RNW+T DD +LA + K++ +++ ++ G Sbjct: 531 RNWQTTVFDDSDLATMGVNKESLSNEMDYSKSLG 564 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.4 bits (53), Expect = 3.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 244 RPFHAFHLALSTRPLGWAMLTSPMV 170 + FHA L L +RP G+ + +P++ Sbjct: 302 KKFHAVRLTLRSRPAGFGLRCNPIL 326 >SPBC21H7.03c |||acid phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 25.4 bits (53), Expect = 3.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 150 YSLYKQATIGDVNIAQPSGLVESAKW 227 Y L+ + + D+N A+ +VESAKW Sbjct: 150 YKLF-DSYVYDINTAEQERVVESAKW 174 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 25.4 bits (53), Expect = 3.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 93 ADKVRNWKTKPSDDENLALYSLYK 164 A+ V NW + +D ENL++ S ++ Sbjct: 526 AENVNNWMLETNDHENLSMQSHFE 549 >SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2|||Manual Length = 1157 Score = 25.0 bits (52), Expect = 4.6 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 202 AVLWRAPSGR--HGTVAKASPKTMPRSNTSKMRRNSTPNT 315 AVL R PSG GT+A P ++ N S RRNS+ ++ Sbjct: 453 AVLNR-PSGETCSGTLALYRPNSLALKNQSSHRRNSSTSS 491 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 25.0 bits (52), Expect = 4.6 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 309 WSGVSPHFR-CIASWHRLGRCLCDRSM 232 W SP+ R I +HRLGR L +R + Sbjct: 457 WRLASPNIRFLITLYHRLGRILRERKL 483 >SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 24.6 bits (51), Expect = 6.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 188 HCPAQRSCGERQVEGMERSQRHLPRRCQE 274 +CPAQR G V G S+R + + +E Sbjct: 486 YCPAQREYGRLNVVGTLMSKRKIMKLVKE 514 >SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 3227 Score = 24.6 bits (51), Expect = 6.1 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -2 Query: 176 YGSLLVQGVQRKVLIVTGLGLPVPNLIGDLFELLVERHFVLSFEIRR 36 + +L + + I+ + P+L+ F LLV+ VL FE +R Sbjct: 2805 FKTLFISFTEEHRKIINMMVFTTPSLMSGSFSLLVKNPKVLEFENKR 2851 >SPAC4G8.04 |||GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 772 Score = 24.2 bits (50), Expect = 8.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 30 TLPPDLKR*HKMSLDEQFKQVADKVRNWKTKPSDDENL 143 T PP ++ K LD K++ D+ + +PS D L Sbjct: 360 TQPPSMRNDWKDYLDNNSKEILDQFGFLQKRPSHDTPL 397 >SPAC1F8.01 |ght3||hexose transporter Ght3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 555 Score = 24.2 bits (50), Expect = 8.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 193 AMLTSPMVACLYREYSARFSSSLGLVFQFLTLSA 92 AML+SP + ++YS F S + ++ + L ++A Sbjct: 73 AMLSSPFTERIGKKYSICFFSGVYIIAELLLVTA 106 >SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1573 Score = 24.2 bits (50), Expect = 8.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -2 Query: 182 ITYGSLLVQGVQRKVLIVTGLGLPVPNLIGDLFELLVERHFVLS 51 I +G + G+ ++ + LG+ PN +G L + LV + +S Sbjct: 285 ILHGECVAIGMVKEAELARYLGILKPNAVGRLTKCLVSYNLPIS 328 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,824,516 Number of Sequences: 5004 Number of extensions: 39122 Number of successful extensions: 121 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 142254980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -