BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c17r (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H12.03 |||mitochondrial hydrolase|Schizosaccharomyces pomb... 28 1.2 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 26 4.8 SPCC737.04 |||S. pombe specific UPF0300 family protein 6|Schizos... 25 8.4 SPACUNK4.06c |rpb7|SPAPYUK71.02|DNA-directed RNA polymerase comp... 25 8.4 SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces p... 25 8.4 >SPAC22H12.03 |||mitochondrial hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 28.3 bits (60), Expect = 1.2 Identities = 22/75 (29%), Positives = 38/75 (50%) Frame = -1 Query: 581 FLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARITGLDLSARDWENNVLRLGTNDA 402 F+K+ KL +K I+G ++GA A VT KV ++ +D S W ++ R A Sbjct: 80 FMKDHKL--DKASIIGHSMGAKTAMVTALKWPDKVEKLVVVDNS--PWYQDLPR--DYGA 133 Query: 401 QYVEVIHTDGSGVNK 357 + ++I D + + K Sbjct: 134 YFRKMIQIDEANITK 148 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 318 KEVNVSNSNAQAVFVDTRSVGVNNFNVLSIVCSQ 419 +E ++S ++ ++FV S VN F+V S+ S+ Sbjct: 176 REKSISKASEYSIFVGDLSPNVNEFDVYSLFASR 209 >SPCC737.04 |||S. pombe specific UPF0300 family protein 6|Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 25.4 bits (53), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 76 KWNGYLMPVFTRNIPDPCFTSL 141 K +GY+ P+F +P CF SL Sbjct: 374 KKSGYMQPLFDLTMPLGCFDSL 395 >SPACUNK4.06c |rpb7|SPAPYUK71.02|DNA-directed RNA polymerase complex II subunit Rpb7|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 25.4 bits (53), Expect = 8.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 392 EVIHTDGSGVNKNGLGVAIGHIDFFVNGRLVQP 294 EV+ + VNK G IG ++ FV+ LV P Sbjct: 86 EVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPP 118 >SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 8.4 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 300 DKTAVDKEVNVSNSNAQAV--FVDTRSVGVNNFN 395 DK K+ V NSN +++ F ++G+N+FN Sbjct: 72 DKKTEFKQDEVPNSNGKSIPTFHPCNNIGINDFN 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,992,658 Number of Sequences: 5004 Number of extensions: 62314 Number of successful extensions: 180 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -