BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c12r (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.4 SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.7 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 497 VTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSN 363 VT SNV + YN+ + + +N++ V + N I+ S SN Sbjct: 157 VTNSNVTIEHFYNVKGNVDSLFFLNNDSVAISGNFTEISPFSSSN 201 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 384 QPSQWKQQLCWYLGLGCR 331 QP QW Q+LC L CR Sbjct: 1785 QPFQWFQELCVKAFLACR 1802 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,307,905 Number of Sequences: 5004 Number of extensions: 39330 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -