BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c12f (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13800.1 68417.m02139 permease-related contains 9 predicted t... 29 1.8 At3g56880.1 68416.m06327 VQ motif-containing protein contains PF... 29 2.4 At4g30180.1 68417.m04291 expressed protein 28 4.1 At5g57180.2 68418.m07143 expressed protein ; supporting cDNA gi|... 28 5.5 At5g57180.1 68418.m07142 expressed protein ; supporting cDNA gi|... 28 5.5 At5g67370.1 68418.m08495 expressed protein similar to unknown pr... 27 7.2 At1g07570.2 68414.m00811 protein kinase (APK1a) identical to Pro... 27 9.6 At1g07570.1 68414.m00810 protein kinase (APK1a) identical to Pro... 27 9.6 >At4g13800.1 68417.m02139 permease-related contains 9 predicted transmembrane domains; contains Pfam PF05653: Protein of unknown function (DUF803); identified as COG0697, Permeases of the drug/metabolite transporter (DMT) superfamily Length = 336 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 246 HKSSKMGVSTSVGGRTTHNPGTVEVSGFLGASKT 145 HK+ MG STS+ G T+H+P V G+S++ Sbjct: 294 HKTKDMGNSTSLRGSTSHSPRDTPVFINSGSSRS 327 >At3g56880.1 68416.m06327 VQ motif-containing protein contains PF05678: VQ motif Length = 245 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 225 PPSCWTCDRTDEWQNFHLRSFLTDQHPLRDRRSLLEDQESPGSSVHPRS 371 PPSC DR+ SFL++ H + +++ D +P S H +S Sbjct: 168 PPSCGNLDRSSAVPTLDTSSFLSNHH----QENIITDLGAPTGSFHHQS 212 >At4g30180.1 68417.m04291 expressed protein Length = 158 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 47 SSQQY*WRWRPWSWQKRPSNLTTTTRSVSPGPRVLDAPRK 166 S+Q++ W SN TTTT S S G R+L+ P K Sbjct: 62 SAQEFAWSRFLLQKLSSSSNPTTTTSSSSDGIRILERPDK 101 >At5g57180.2 68418.m07143 expressed protein ; supporting cDNA gi|13991645|gb|AF359387.1|AF359387 Length = 435 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 98 PSNLTTTTRSVSPGPRVLDAPRKPL 172 PS+ TTTTR+ SP + ++ PL Sbjct: 27 PSSSTTTTRATSPSSTISESSNSPL 51 >At5g57180.1 68418.m07142 expressed protein ; supporting cDNA gi|13991645|gb|AF359387.1|AF359387 Length = 424 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 98 PSNLTTTTRSVSPGPRVLDAPRKPL 172 PS+ TTTTR+ SP + ++ PL Sbjct: 27 PSSSTTTTRATSPSSTISESSNSPL 51 >At5g67370.1 68418.m08495 expressed protein similar to unknown protein (gb|AAC18972.1) Length = 327 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 183 YQDCGWFCRQRWCSPPSCWTCDR 251 Y++ GW+ Q W PP DR Sbjct: 185 YEESGWYDGQMWVKPPEVLARDR 207 >At1g07570.2 68414.m00811 protein kinase (APK1a) identical to Protein kinase APK1A from [Arabidopsis thaliana] SWISS-PROT:Q06548 Length = 410 Score = 27.1 bits (57), Expect = 9.6 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = -3 Query: 201 TTHNPGTVEVSGFLGASKTLGPGDTDLVVVVKFDGLFCHDHGRQRHQYCCEDLHG--YYQ 28 T PGT V ++ G + + V + G F H H + YC ED H Y+ Sbjct: 93 TASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDEHRLLVYE 152 Query: 27 F--TGSLE 10 F GSLE Sbjct: 153 FMPRGSLE 160 >At1g07570.1 68414.m00810 protein kinase (APK1a) identical to Protein kinase APK1A from [Arabidopsis thaliana] SWISS-PROT:Q06548 Length = 410 Score = 27.1 bits (57), Expect = 9.6 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = -3 Query: 201 TTHNPGTVEVSGFLGASKTLGPGDTDLVVVVKFDGLFCHDHGRQRHQYCCEDLHG--YYQ 28 T PGT V ++ G + + V + G F H H + YC ED H Y+ Sbjct: 93 TASRPGTGLVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDEHRLLVYE 152 Query: 27 F--TGSLE 10 F GSLE Sbjct: 153 FMPRGSLE 160 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.130 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,347,139 Number of Sequences: 28952 Number of extensions: 196650 Number of successful extensions: 795 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -