BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c10r (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11770.1 68418.m01374 NADH-ubiquinone oxidoreductase 20 kDa s... 253 1e-67 At3g12180.1 68416.m01519 cornichon family protein contains Pfam ... 28 5.2 At2g24700.1 68415.m02951 transcriptional factor B3 family protei... 28 5.2 At1g04200.1 68414.m00410 expressed protein Contains similarity t... 27 9.1 >At5g11770.1 68418.m01374 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial identical to NADH-ubiquinone oxidoreductase 20 kDa subunit mitochondrial [precursor] SP:Q42577 from [Arabidopsis thaliana]; contains Pfam profile: PF01058 NADH ubiquinone oxidoreductase, 20 Kd subunit Length = 218 Score = 253 bits (619), Expect = 1e-67 Identities = 117/175 (66%), Positives = 130/175 (74%) Frame = -1 Query: 544 THLPAPNPTEKRPYSPFQDASNMAEMAVARLDDLLNWGRKGSLWPMTFGLACCAVEMMHI 365 T P P P P S AE ++++DDL+NW R GS+WPMTFGLACCAVEMMH Sbjct: 44 TSYTRPGPPSTSPPPP--GLSKAAEFVISKVDDLMNWARTGSIWPMTFGLACCAVEMMHT 101 Query: 364 AAPRYDMDRYGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPDPRWVISMGSCANX 185 A RYD+DR+G++FR SPRQSD MIVAGTLTNKMAPALRKVYDQMP+PRWVISMGSCAN Sbjct: 102 GAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANG 161 Query: 184 XXXXXXXXXXXXGCDRIVPVDIYVPGCPPTAEALLYGVLQLQKKIKRMKTIQVWY 20 GCDRIVPVDIYVPGCPPTAEALLYG+LQLQKKI R K W+ Sbjct: 162 GGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGLLQLQKKINRRKDFLHWW 216 >At3g12180.1 68416.m01519 cornichon family protein contains Pfam profile: PF03311 cornichon protein Length = 146 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -2 Query: 231 CLILDGLFQWVVVLMEVAITTIHTLS*EDAIVLYQLTYMYPDVHLQLKLYY 79 CL+ + WV L+ V +T H + ++ L +T ++ + + KL Y Sbjct: 61 CLLFLLTWHWVFFLVAVPVTVYHAMLYKERRYLIDVTEVFRGISFEKKLRY 111 >At2g24700.1 68415.m02951 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 555 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +1 Query: 235 GRTLSSKLEPFCLLKFLLQS---LHQTDGEMLGILRHIGPYHSEVQQYASSLQRSKLDQR 405 GR LS+ E F + L + + +GE++ + +GP E+Q +L+ K+++ Sbjct: 63 GRRLSNGWEDFTIAHDLRVGDIVVFRQEGELVFHVTALGPSCCEIQYGEDTLEEDKIEKL 122 Query: 406 SWAKGNLSSPNSISHQVEPQP 468 + S S+ + E P Sbjct: 123 CGTENVSSKKKSLKREAESAP 143 >At1g04200.1 68414.m00410 expressed protein Contains similarity to gb|Z69902 from C. elegans Length = 732 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 437 LGEERFPLAHDLWSSLL 387 +GE+ FPLA D W+ LL Sbjct: 27 VGEKSFPLASDFWNKLL 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,864,300 Number of Sequences: 28952 Number of extensions: 340998 Number of successful extensions: 800 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -