BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c06r (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 39 4e-05 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 23 3.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 3.0 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 23 3.0 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 4.0 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 5.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.3 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 38.7 bits (86), Expect = 4e-05 Identities = 22/58 (37%), Positives = 33/58 (56%) Frame = -3 Query: 545 ESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVK 372 + Y E R KNNEA+KRSR R+ KE ++ LE N L+ D L++ +K++ Sbjct: 135 DPSYWEKRRKNNEAAKRSRDARRAKEDEIAIRCAFLERENCHLKFVTDTLKKELEKLQ 192 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +2 Query: 569 FHQCCMWMIVCCLVSWGVGL 628 FH + C++SW VG+ Sbjct: 171 FHNLTLITYSLCVISWAVGI 190 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 589 PHAALMKIHQIFPLKN 542 P ALM+I IFP+KN Sbjct: 66 PIYALMRIVGIFPIKN 81 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +2 Query: 569 FHQCCMWMIVCCLVSWGVGL 628 FH + C++SW VG+ Sbjct: 171 FHNLTLITYSLCVISWAVGI 190 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAID 441 QE Y+ELRD ++ + N L+ +E++ ++ Sbjct: 19 QEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLE 54 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 224 VLCSPGCF 231 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 538 VLCSPGCF 545 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 798 VLCSPGCF 805 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 798 VLCSPGCF 805 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 771 VLCSPGCF 778 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 771 VLCSPGCF 778 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 798 VLCSPGCF 805 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 159 LMCSPGCF 182 ++CSPGCF Sbjct: 798 VLCSPGCF 805 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 253 EKSTVVDLLSNKMQMLMSFNNTQNIHNLLH 342 EKS+++DL ++ + S+++ +N+ H Sbjct: 40 EKSSLIDLTESEEKSGGSYSSNKNVSRADH 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,152 Number of Sequences: 336 Number of extensions: 3065 Number of successful extensions: 18 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -