BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c06r (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 48 9e-06 SB_37383| Best HMM Match : bZIP_2 (HMM E-Value=2.5e-06) 45 7e-05 SB_21430| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) 40 0.001 SB_19986| Best HMM Match : bZIP_2 (HMM E-Value=5.7e-17) 40 0.002 SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) 38 0.006 SB_19296| Best HMM Match : bZIP_2 (HMM E-Value=1.1e-08) 38 0.007 SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) 36 0.030 SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 31 0.86 SB_59487| Best HMM Match : DUF1014 (HMM E-Value=2.4) 31 1.1 SB_32735| Best HMM Match : DUF465 (HMM E-Value=1.7) 31 1.1 SB_662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_38737| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 30 2.0 SB_5481| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_57900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_19105| Best HMM Match : 7tm_1 (HMM E-Value=5e-08) 29 2.6 SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) 29 2.6 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 3.5 SB_41081| Best HMM Match : DUF1014 (HMM E-Value=2.9) 29 3.5 SB_55083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_25247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_47298| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 28 6.0 SB_54392| Best HMM Match : G6PD_N (HMM E-Value=1.3) 28 8.0 SB_45175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) 28 8.0 SB_41089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 28 8.0 >SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) Length = 561 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/64 (35%), Positives = 41/64 (64%) Frame = -3 Query: 581 SIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKAD 402 S+ + +++ T++ YRE R KNN ++KRSR RK++E+ + A L++ N +LR Sbjct: 278 SLSKAIADVKTEQ--YREKRRKNNASAKRSREARKMREIHAQTAAAYLQDENAQLRALCH 335 Query: 401 ILEE 390 +L+E Sbjct: 336 VLKE 339 >SB_37383| Best HMM Match : bZIP_2 (HMM E-Value=2.5e-06) Length = 222 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/56 (42%), Positives = 35/56 (62%) Frame = -3 Query: 530 ELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVKDAL 363 E R KNNEASKR+R R+ KE ++ + E+ NK LR + + LE+ K ++ AL Sbjct: 159 EKRRKNNEASKRTREKRRNKEQELLKEKEIKEKENKALRTQVEDLEKQIKDIRSAL 214 >SB_21430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 815 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/56 (39%), Positives = 36/56 (64%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTK 381 ++ KY E R KNN A+KRSR ++ +E++ Q + LE+ N L +A + EEL++ Sbjct: 51 KDQKYIEKRMKNNLAAKRSREAKRQREIEAMQKTLTLEKENSDLNKEA-LAEELSE 105 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/47 (40%), Positives = 32/47 (68%) Frame = -3 Query: 554 STQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLR 414 + +++KY E R +NN ++KRSR R+++EL+ + A LEE N K + Sbjct: 154 NNKDNKYWEKRQRNNASAKRSRDARRVRELECQIRAEFLEEENHKYK 200 >SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) Length = 244 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/53 (39%), Positives = 36/53 (67%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEE 390 ++ KY E R +NN A+KRSR ++ KE+ + + A +LE N+KLR + +L++ Sbjct: 177 KDQKYWERRFENNVAAKRSRDLKRPKEMTVAKRAQNLEIENEKLRNEVTMLKK 229 >SB_19986| Best HMM Match : bZIP_2 (HMM E-Value=5.7e-17) Length = 278 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/69 (30%), Positives = 38/69 (55%) Frame = -3 Query: 602 STLSSTCSIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNK 423 S S SI + +S + +YR+ R++NN A ++SR K K ++ + +L E N+ Sbjct: 178 SRTSRRHSISKRNS-MDKHSEEYRQKRERNNVAVRKSRFKSKQKFIETQSRVEELTEENE 236 Query: 422 KLRVKADIL 396 +L + DI+ Sbjct: 237 RLHSRIDII 245 >SB_3656| Best HMM Match : bZIP_2 (HMM E-Value=1e-09) Length = 241 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/67 (34%), Positives = 35/67 (52%) Frame = -3 Query: 563 SNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELT 384 S+ S K E R +NN+ASK+ R RK K+ + +LE N L+V+ + L Sbjct: 170 SSSSGDSDKSEEKRKRNNQASKKFRQARKGKQQALFAKESELERENYSLKVQVEQLIREL 229 Query: 383 KKVKDAL 363 ++K AL Sbjct: 230 NQLKAAL 236 >SB_19296| Best HMM Match : bZIP_2 (HMM E-Value=1.1e-08) Length = 216 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKL 417 ++ KY E R KNN A+KRSR ++ +E++ Q + LE+ N L Sbjct: 170 KDQKYIEKRMKNNLAAKRSREAKRQREIEAMQKTLTLEKENSDL 213 >SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) Length = 298 Score = 35.9 bits (79), Expect = 0.030 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEE 390 ++ +Y R KNN A++RSR R+ KE+++ LE+ N +LR + L++ Sbjct: 167 KDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQLEKENARLREELQQLKD 219 >SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 35.5 bits (78), Expect = 0.040 Identities = 19/55 (34%), Positives = 32/55 (58%) Frame = -3 Query: 581 SIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKL 417 SI S +IS +E R+ +D N + +K+ + + E E+L DL+E+N+KL Sbjct: 1252 SIQRLSFDISPEECACRKQQDSNADRAKQIKTTATVNEDPTEKLIRDLQEQNEKL 1306 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 563 SNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLR 414 S + +ESK RE +DK E +R +K ++ Q + + ER +K R Sbjct: 975 SEVDAEESKKREKKDKEKEKRERELQRKKERDEQKRKKEEEKREREEKKR 1024 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/58 (36%), Positives = 37/58 (63%) Frame = -3 Query: 530 ELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVKDALMA 357 EL DK+ + ++R ++ +E+ + DLEE K+ V ADI+++L K++KDA+ A Sbjct: 330 ELMDKHEDLAER--VDGLEEEMPKKANLEDLEELRKRPAVPADIVDQL-KRLKDAMDA 384 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 32.3 bits (70), Expect = 0.37 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = -3 Query: 575 DENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEE-RNKKLRVKADI 399 D S+ I + + +L DK E + R K++E +M +D + ++K++ + Sbjct: 1957 DTVSNAIEASQREENKLVDKYEEEIREYRKELKMREDEM----LDYKRITDQKVQESEQM 2012 Query: 398 LEELTKKVKDALMAAILQK*SKL 330 +EEL K+ +DAL+AA SK+ Sbjct: 2013 VEELKKQHEDALLAAEADYHSKM 2035 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 31.9 bits (69), Expect = 0.49 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = -3 Query: 545 ESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVKDA 366 + + R+ ++N A+ R R RK+ Q+E+ A DL N +L+ I T + K Sbjct: 375 DERRRKFLERNRAAATRCREKRKIWVQQLEKKADDLSNTNTQLQTSDKITINKTFRNKKL 434 Query: 365 LMAAIL 348 M +L Sbjct: 435 KMKNVL 440 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 31.1 bits (67), Expect = 0.86 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -3 Query: 545 ESKYRELRDKNNEASKRSRMNRKLKELQMEQL-AIDLEERNKKLRVKADILEELTKKVKD 369 E +Y E + K + KR RKL+E ++ Q+ D E+R R+K + + ++KD Sbjct: 727 EKRYEEEKQKIEDDKKRWEEERKLREDEINQMFNDDQEKREGDWRIKESGIGKDFDRIKD 786 Query: 368 ALMAAILQK 342 I+ K Sbjct: 787 GERETIMIK 795 >SB_59487| Best HMM Match : DUF1014 (HMM E-Value=2.4) Length = 176 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/61 (32%), Positives = 32/61 (52%) Frame = -3 Query: 548 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVKD 369 +E K E + + E KR RK +E + ++ A +EE NKK K EE K++++ Sbjct: 7 EEEKQLE-KQRKAEEEKRKEEQRKAEEEKQKEEAKRIEEENKKKEEKEK--EEARKRLEE 63 Query: 368 A 366 A Sbjct: 64 A 64 >SB_32735| Best HMM Match : DUF465 (HMM E-Value=1.7) Length = 87 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = -3 Query: 578 IDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADI 399 ++E + S E Y+E +EA L LQ+E+ +L ER +KL K D Sbjct: 5 VEELRARCSKLEELYKEAVKAKDEAVDERNKATVLIVLQLERETAELNERIEKLEEKNDK 64 Query: 398 LE 393 LE Sbjct: 65 LE 66 >SB_662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/59 (28%), Positives = 33/59 (55%) Frame = -3 Query: 563 SNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEEL 387 S +S ++ + +L+ N + S + + + K+K ++EQ DLEER + V + E+L Sbjct: 253 SMVSDKDEEISQLKGTNADLSSQIKES-KVKNQELEQRVKDLEERMSQASVNQNAKEQL 310 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = -3 Query: 566 SSNISTQESKYRELRDKNNEASKRSRMNRKL--KELQMEQLAID-LEERNKKLRVKADIL 396 +S + +E + + + A K+ + R+ KEL + I+ L ERNK+LR K Sbjct: 1366 NSELIEREEEVEHFKAEQETAMKKLQEARESEGKELVLRTEEIEKLYERNKELREKERDY 1425 Query: 395 EELTKKVKD 369 EEL K++D Sbjct: 1426 EELKTKMRD 1434 >SB_38737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 1/70 (1%) Frame = -3 Query: 572 ENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRV-KADIL 396 +N SN ++ + ++ + E +R+R+N L EL+ L ++ ++ ++ KADIL Sbjct: 9 QNDSNKTSLKMDNKKSKKPQMEKLRRARINDSLNELKSLVLEAMKKDASRYSKMEKADIL 68 Query: 395 EELTKKVKDA 366 E K ++ A Sbjct: 69 EMTVKYLRSA 78 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = -3 Query: 527 LRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADILEELTKKVKD 369 L+ N + KR + L ++LA D+EE+N +L V+ ++ L+KK++D Sbjct: 277 LQQANRDLEKRLKNALDKHALASQKLA-DVEEKNAELLVELKGVDRLSKKLED 328 >SB_5481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 217 TCIVLLCSLVKTEKSTVVDL-LSN-KMQMLMSFNNTQNIHNLLHFCK 351 T I L +V T K T++D +SN K + L +F+NT IH+ + K Sbjct: 206 TTIHLPFIIVNTSKKTIIDCSISNDKFEYLFNFDNTFEIHDDIEVLK 252 >SB_831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/67 (25%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = -3 Query: 578 IDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKL-RVKAD 402 +++ + + QE + L N+E ++ +R + E++ ++ +DLE + K++ RV+ + Sbjct: 50 LEKTNERVEEQEKLLQNLVH-NSEMNEEARKGLEESEMKGDEKIMDLEAKLKEMERVEKE 108 Query: 401 ILEELTK 381 LE LT+ Sbjct: 109 TLETLTE 115 >SB_57900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 572 ENSSNISTQESKYRELRDKNNEASKRSRMNR--KLKELQMEQLAIDLEERNKK 420 E S N++TQ++ EL E K SRM + + + M +L DL+ NK+ Sbjct: 4 EESENMATQDNNDEELHPATQEEEKPSRMTQFPQTRVRNMMKLDPDLQLANKE 56 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -3 Query: 575 DENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNK-KLRVKADI 399 D S+++ + R L+DK N ++ + ++ E +++Q+ DL+ K K +++ D+ Sbjct: 2159 DIESNHMKQEVEHERMLKDKINREKEKFQADKYRLEQELDQVQEDLDRATKDKHKLEQDL 2218 Query: 398 LE 393 LE Sbjct: 2219 LE 2220 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Frame = -3 Query: 596 LSSTCSIDENSSNISTQ-ESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNK- 423 L ++ E+ N + Q +K RE+ ++ E + R+ RK++E++ Q I EERN+ Sbjct: 163 LEDVQALQEDERNKTLQVRNKQREVEIEHREYAARAE--RKMREVEERQRLIAEEERNRQ 220 Query: 422 ---KLRVKADILEELTKKVKDALMAAI 351 +L K + L +K+ +A+ I Sbjct: 221 ELAQLCSKHHEIHALVQKLDEAVKQCI 247 >SB_19105| Best HMM Match : 7tm_1 (HMM E-Value=5e-08) Length = 791 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 640 GPEEEADPPRDETAHYHPHAALM 572 G E +A+P DE H++PHAAL+ Sbjct: 500 GDENDAEPSSDE--HFYPHAALL 520 >SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) Length = 1284 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 13/84 (15%) Frame = -3 Query: 581 SIDENSSNISTQE---SKYRELRD-----KNNEASKRSRMNRKLKELQMEQ-----LAID 441 +++EN+S +++E S +EL D +N +A+ S++N K+ + + L+I Sbjct: 526 ALEENTSLKTSKEQYESTIKELNDSIMELENRKATLTSKLNSITKDCEESKKESRALSIC 585 Query: 440 LEERNKKLRVKADILEELTKKVKD 369 LEE+ + L + EEL KK+++ Sbjct: 586 LEEKTRNLHEEKRRKEELEKKIEE 609 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/72 (19%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = -3 Query: 578 IDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKEL--QMEQLAIDLEERNKKLRVKA 405 I+ I E + L+D+NN K + K+ L ++++ +++ E+ + L+ + Sbjct: 1314 IESYEDKIKALEKEISNLKDRNNNGEKVQELLHKVTYLEGELKERSVETEKLKQTLQERE 1373 Query: 404 DILEELTKKVKD 369 + +E L ++ ++ Sbjct: 1374 EQIERLKEEFQE 1385 >SB_41081| Best HMM Match : DUF1014 (HMM E-Value=2.9) Length = 340 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -1 Query: 634 EEEADPPRDETAHYHPHAALMKIHQIFPLKNQSIES*ETRIMKL 503 E +++ PR E+A + HA + IH P +++S+ R+M+L Sbjct: 288 EPKSESPRSESADGNGHALMDVIHDGSPDEDRSVALGRERVMRL 331 >SB_55083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 253 EKSTVVDLLSNKMQML-MSFNNTQNIHNLLHFCKIAAINASFTFL 384 E S + L N + +L + F N+Q +HN+ + +I+ S TFL Sbjct: 119 ELSIDISCLENTILLLSVDFPNSQLVHNIFNVLSTESIDYSLTFL 163 >SB_25247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/80 (21%), Positives = 44/80 (55%) Frame = -3 Query: 581 SIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKAD 402 +++E+ S I + + R+ + ++ NRK+KE + +L + N + VK + Sbjct: 12 NVEEDESGIIIETRAQKRKRENDQVFESQAGYNRKMKETRPRKLNF---QENDYVSVKIN 68 Query: 401 ILEELTKKVKDALMAAILQK 342 ++++ + +++L+A I++K Sbjct: 69 VVDK-GQLHQNSLLAKIIEK 87 >SB_47298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.7 bits (61), Expect = 4.6 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 10/86 (11%) Frame = -3 Query: 602 STLSSTCSIDENSSN---ISTQESK-------YRELRDKNNEASKRSRMNRKLKELQMEQ 453 S SS SID N I T E+K R LRD+++EASK + + EL + + Sbjct: 199 SKSSSELSIDANKEQRELIQTLENKNRLLLKEIRRLRDEHDEASKSAAQLAQNPEL-LAE 257 Query: 452 LAIDLEERNKKLRVKADILEELTKKV 375 L + L +R +L ++ L+E +++ Sbjct: 258 LKL-LRQRKDELELRMSALQESRREL 282 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 527 LRDKNNEASKRSRMNRKLKEL--QMEQLAIDLEERNKKLRVKADILEELTKKVKDALMAA 354 L + E ++R L++L + EQ ID+EE+ L+ +A + KKV LM+A Sbjct: 408 LEESAKELAERRERQENLQKLIKEKEQERIDIEEKYASLQEEASGKTKKLKKVWTMLMSA 467 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = -3 Query: 605 DSTLSSTCSIDENSSNISTQESKYRELRDKNNEASKRSR-MNRKLKEL-----QMEQLAI 444 D C+++ + I E+K +L NN+ + K+ +L ++E LA Sbjct: 176 DRVTEFKCTLEARDNRIVELENKLEDLESPNNKLHHSPQFQGEKISDLEGQIDELESLAA 235 Query: 443 DLEERNKKLRVKADILEELTKKVKD 369 + ++ L K + EL +V+D Sbjct: 236 EKNRLSQSLEQKMKKIMELENRVED 260 >SB_54392| Best HMM Match : G6PD_N (HMM E-Value=1.3) Length = 277 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/88 (22%), Positives = 46/88 (52%), Gaps = 1/88 (1%) Frame = -3 Query: 602 STLSS-TCSIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERN 426 ST+ S +++E+ S I + + R+ + ++ NRK+KE + +L + N Sbjct: 155 STIESHNQNVEEDESGIIIETRAQKRKRENDQVFENQASYNRKMKETRPRKLNF---QEN 211 Query: 425 KKLRVKADILEELTKKVKDALMAAILQK 342 + VK +++++ ++L+A I++K Sbjct: 212 DYVSVKINVVDK-GPLHPNSLLAKIIEK 238 >SB_45175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 3/72 (4%) Frame = -3 Query: 578 IDENSSNISTQESKYRELRDKNNEASKR-SRMNRKLK--ELQMEQLAIDLEERNKKLRVK 408 +DE T E++ + + +A +R S + R ++ E+Q E+ LEE KL+ Sbjct: 8 LDEARDRKETAETETGTAKRRAEKAEERASALYRHIQMTEMQFEKTIARLEEAQHKLKAA 67 Query: 407 ADILEELTKKVK 372 A + ++ +K++ Sbjct: 68 ATVKQDNREKIR 79 >SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) Length = 1088 Score = 27.9 bits (59), Expect = 8.0 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = -3 Query: 605 DSTLSSTCSIDE--NSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEE 432 D+ LS T +D N + E+K ++ + + R +QM++ I + Sbjct: 400 DNLLSLTIPMDAVLNKEEFAEYEAKQKQAEETKERLTTRFVTFPDYLMVQMKKFTIGEDW 459 Query: 431 RNKKLRVKADILEEL 387 KKL V +ILEEL Sbjct: 460 VPKKLDVALEILEEL 474 >SB_41089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/80 (21%), Positives = 43/80 (53%) Frame = -3 Query: 581 SIDENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKAD 402 +++E+ S I + ++ R+ + ++ NRK+KE + +L + N + VK + Sbjct: 12 NVEEDESGIIIETRAQKQKRENDQVFENQAGYNRKMKETRTRKLNF---QENYYVSVKIN 68 Query: 401 ILEELTKKVKDALMAAILQK 342 ++++ ++L+A I++K Sbjct: 69 VVDKGLLH-PNSLLAKIIEK 87 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 27.9 bits (59), Expect = 8.0 Identities = 21/70 (30%), Positives = 37/70 (52%) Frame = -3 Query: 575 DENSSNISTQESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERNKKLRVKADIL 396 +E SN ST E++ L+ K+ E K ++ Q+E+L + E+ K + + + L Sbjct: 477 EEYDSNKSTHENELLVLKAKHEEELKETKQ-------QLEEL--EKEKSEKLTKEQEEAL 527 Query: 395 EELTKKVKDA 366 EE KK+ +A Sbjct: 528 EEERKKLTEA 537 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,197,213 Number of Sequences: 59808 Number of extensions: 328379 Number of successful extensions: 1303 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1298 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -