BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= fmgV10c06f
         (598 letters)
Database: nematostella 
           59,808 sequences; 16,821,457 total letters
Searching..................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
SB_7241| Best HMM Match : Cyclin_N (HMM E-Value=2.4e-20)               28   6.6  
>SB_7241| Best HMM Match : Cyclin_N (HMM E-Value=2.4e-20)
          Length = 279
 Score = 27.9 bits (59), Expect = 6.6
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +2
Query: 173 HTFIVLRPTLGTVSCLGA*RVNISLGAQEEFNQVSKI 283
           HTF+   P+L T SC+ A R+ ++L      N++SK+
Sbjct: 209 HTFLSFSPSLITSSCIAASRICLNL-IPSWTNELSKV 244
  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,294,452
Number of Sequences: 59808
Number of extensions: 271101
Number of successful extensions: 464
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 447
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 464
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -