BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c06f (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61460.1 68418.m07712 structural maintenance of chromosomes (... 31 0.44 At1g75200.1 68414.m08736 flavodoxin family protein / radical SAM... 27 7.2 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 27 7.2 >At5g61460.1 68418.m07712 structural maintenance of chromosomes (SMC) family protein very strong similarity to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1057 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 222 PKQLTVPRVGLSTMNVCKSFKTRVRCDSVFVKKESNLNEQCLRR 91 P Q T+P + +C SF +++ + KE N QC+RR Sbjct: 617 PVQTTLPPLSRRPSRLCASFDDQIKDLEIEASKEQNEINQCMRR 660 >At1g75200.1 68414.m08736 flavodoxin family protein / radical SAM domain-containing protein contains Pfam profiles PF00258: Flavodoxin, PF04055: radical SAM domain protein Length = 647 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 20 SRRARVALSILRNS*TFYILYLLRRLKH 103 S R R+A L ++ TFY ++ RRLKH Sbjct: 6 SVRVRLAFVALLSATTFYCIHKYRRLKH 33 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 380 MFIWIFFLLERFFAHLV 330 MFIW+FF + +FF HLV Sbjct: 888 MFIWLFF-IHQFFNHLV 903 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,805,457 Number of Sequences: 28952 Number of extensions: 195443 Number of successful extensions: 409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -