BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c02r (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47699| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-23) 31 1.3 SB_21528| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 >SB_47699| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-23) Length = 335 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -1 Query: 539 VIIEHNEQLYNFLVSGNA-TYTNGFLVSIEKIDV 441 VIIE++ LY L + + TYTNGF+VS+ D+ Sbjct: 18 VIIENSVVLYLVLANRHMRTYTNGFVVSLASSDI 51 >SB_21528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 6 YDLTIKANIWERYFIFRLLQQYRSEMCSPVFSAIPVHAWYE-TSRQSFGD 152 YD NIW+ ++ ++ C+ F A P+ +W + TSR GD Sbjct: 285 YDYMANFNIWDYAINQTIIDAVYAQGCTGSFFATPILSWGQITSRPISGD 334 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,392,698 Number of Sequences: 59808 Number of extensions: 504641 Number of successful extensions: 1262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -