BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c02r (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 2.2 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 23 3.0 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 3.9 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 5.2 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 5.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 5.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 6.8 AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor pr... 21 9.0 AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor pr... 21 9.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.0 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/59 (22%), Positives = 27/59 (45%) Frame = +1 Query: 37 NGILFFAFSNNIEAKCVPQFSALFLFMLGTKRLDKASVMLSVGM*SIRTVALGIRLNSL 213 NG+LFF NN C + L + ++ ++ + + + I+ +A R+N + Sbjct: 315 NGVLFFGLVNNSAIGCWNEHQPLQRQNMDMVAQNEKTLQMIISVKIIQNLAYSGRMNRI 373 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 153 AVRWHVVHPDCSTGHQTQQPHR 218 A+ W+ HP+ G Q + P R Sbjct: 116 ALEWNAAHPEEDDGGQPRPPGR 137 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 408 NIPGDSLFHIRDIYLLYGH*KP 473 N+P + L HI + +L+Y P Sbjct: 24 NVPAEELIHIPEHWLVYPEPNP 45 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 385 VGTLAPFTISLVTLCSIFVTSIFSMDTRNPL 477 +G FT+ LVTL + ++ +++ R+P+ Sbjct: 299 LGKYLLFTMVLVTLSVVVTIAVLNVNFRSPV 329 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 5.2 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 497 SGNATYTNGFLVSIEKIDVTNMEQRVT----RDIVNG 399 SGN T ++ I + +N E RVT +I+NG Sbjct: 12 SGNWGSTIAKIIGINAANFSNFEDRVTMYVYEEIING 48 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 37 NGILFFAFSNNIEAKC 84 NG+LFF NN C Sbjct: 315 NGVLFFGLMNNSAIGC 330 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 510 QLPGIRKRDLH*RVSSVHREDR 445 QLPG ++ R++ ++REDR Sbjct: 373 QLPGTGRQSELLRLNGINREDR 394 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 510 QLPGIRKRDLH*RVSSVHREDR 445 QLPG ++ R++ ++REDR Sbjct: 373 QLPGTGRQSELLRLNGINREDR 394 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 356 RDVKVGFDVDAHINDELRHY 297 +DV V +D HI + +R Y Sbjct: 674 KDVDVTLPLDLHIQNAIREY 693 >AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 9.0 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -1 Query: 503 LVSGNATYTNGFLVSIEKIDVTNMEQRVTRDIVNGASVPTALVRGRL-NLRDVKVGFDVD 327 LVS + T+ + +DV + + IV+GA+V L+ L N+ + + +V Sbjct: 18 LVSDVSAKTSISVKGESNVDVVSQINSLVSSIVSGANVSAVLLAQTLVNILQILIDANVF 77 Query: 326 A 324 A Sbjct: 78 A 78 >AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 9.0 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -1 Query: 503 LVSGNATYTNGFLVSIEKIDVTNMEQRVTRDIVNGASVPTALVRGRL-NLRDVKVGFDVD 327 LVS + T+ + +DV + + IV+GA+V L+ L N+ + + +V Sbjct: 18 LVSDVSAKTSISVKGESNVDVVSQINSLVSSIVSGANVSAVLLAQTLVNILQILIDANVF 77 Query: 326 A 324 A Sbjct: 78 A 78 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 368 RLNLRDVKVGFDVDAHINDE 309 +LN +D+ G + AHI D+ Sbjct: 155 KLNTQDIVPGVRIGAHILDD 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,928 Number of Sequences: 438 Number of extensions: 4606 Number of successful extensions: 17 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -