BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c02r (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49590.2 68416.m05420 expressed protein 29 3.2 At3g49590.1 68416.m05419 expressed protein 29 3.2 At3g16240.1 68416.m02049 delta tonoplast integral protein (delta... 29 3.2 At2g33400.1 68415.m04094 expressed protein 29 3.2 At3g26520.1 68416.m03310 tonoplast intrinsic protein, putative s... 29 4.2 At2g36830.1 68415.m04516 major intrinsic family protein / MIP fa... 29 4.2 At5g47450.1 68418.m05853 major intrinsic family protein / MIP fa... 27 9.7 At4g17340.1 68417.m02601 major intrinsic family protein / MIP fa... 27 9.7 At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM dom... 27 9.7 At3g44380.1 68416.m04768 expressed protein predicted proteins, A... 27 9.7 >At3g49590.2 68416.m05420 expressed protein Length = 603 Score = 29.1 bits (62), Expect = 3.2 Identities = 22/60 (36%), Positives = 28/60 (46%) Frame = +1 Query: 328 STSKPTFTSLKFNLPRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNPLV*VAFPDTRK 507 S S P + S N PR N AP TI + +V+S FS RNPL + TR+ Sbjct: 345 SPSTPRYIS-GGNSPRINVRPGTAPVTIPSSATLNRYVSSNFSEPGRNPLPPFSPKSTRR 403 >At3g49590.1 68416.m05419 expressed protein Length = 603 Score = 29.1 bits (62), Expect = 3.2 Identities = 22/60 (36%), Positives = 28/60 (46%) Frame = +1 Query: 328 STSKPTFTSLKFNLPRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNPLV*VAFPDTRK 507 S S P + S N PR N AP TI + +V+S FS RNPL + TR+ Sbjct: 345 SPSTPRYIS-GGNSPRINVRPGTAPVTIPSSATLNRYVSSNFSEPGRNPLPPFSPKSTRR 403 >At3g16240.1 68416.m02049 delta tonoplast integral protein (delta-TIP) identical to delta tonoplast integral protein (delta-TIP) (GI:9279707)(GB:U39485) [Arabidopsis thaliana] (Plant Cell 8 (4), 587-599 (1996)) Length = 250 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 370 PRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNP 474 P+ ++GT+AP I L+ +I FS + NP Sbjct: 164 PKKGSLGTIAPLAIGLIVGANILAAGPFSGGSMNP 198 >At2g33400.1 68415.m04094 expressed protein Length = 272 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 548 LNDVIIEHNEQLYNFLVSGNATYTNGFLVSIEKIDVTNMEQR 423 L ++I+ N L N+L S + + NG +D+TNME R Sbjct: 233 LKEIIV--NTSLSNWLASPKSLHANGSSKRSPIVDITNMENR 272 >At3g26520.1 68416.m03310 tonoplast intrinsic protein, putative similar to tonoplast intrinsic protein GI:5081419 from [Brassica napus] Length = 253 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 370 PRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNPLV 480 P+ ++GT+AP I + +I FS + NP V Sbjct: 167 PKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAV 203 >At2g36830.1 68415.m04516 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230 Length = 251 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 370 PRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNPLV 480 P+ ++GT+AP I + +I FS + NP V Sbjct: 166 PKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAV 202 >At5g47450.1 68418.m05853 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230 Length = 250 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 370 PRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNP 474 P+ ++GT+AP I + +I FS + NP Sbjct: 164 PKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNP 198 >At4g17340.1 68417.m02601 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230 Length = 250 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 370 PRTNAVGTLAPFTISLVTLCSIFVTSIFSMDTRNP 474 P+ ++GT+AP I + +I FS + NP Sbjct: 164 PKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNP 198 >At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 594 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -1 Query: 545 NDVIIEHNEQLYNFLVSGNATYTNGFLVSIEKIDVTNMEQRVTRDIVNG 399 NDV EQ+ N L++ ++TYTN + S K N+E T + +G Sbjct: 408 NDVFASTPEQVLNVLLADDSTYTNEYR-SARKDKNLNIEPWHTAEEYDG 455 >At3g44380.1 68416.m04768 expressed protein predicted proteins, Arabidopsis thaliana Length = 186 Score = 27.5 bits (58), Expect = 9.7 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = +1 Query: 229 SPDTKFLWTFNSYWTSMCVKAPV*CLSSSLMCASTSKPTF-------TSLKFNLPRTNA 384 S D K W+ W+S + A ++SL+ A PTF TSLK NLP +A Sbjct: 3 SRDQKVKWS----WSSALIGAASATAAASLLSAKPKDPTFHLISIDLTSLKLNLPVLDA 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,226,273 Number of Sequences: 28952 Number of extensions: 348344 Number of successful extensions: 984 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -