BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c02f (641 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.5 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 3.6 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 6.2 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 8.2 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 1.5 Identities = 27/120 (22%), Positives = 56/120 (46%), Gaps = 8/120 (6%) Frame = +3 Query: 114 ILALSYASGQ-NNLVVDTRARVQHHTEYYTKLIQKLVYELEKRGFCNLKLNDVIIEHNEQ 290 ++ LSY+ + ++ V T +QH T +Y+K ++ L+ +++ + KL D + +++ Sbjct: 614 MIDLSYSEDRLADITVATHQFIQHFTFHYSKDVKPLLQTIQQ---SDHKLFDFEYDQHQR 670 Query: 291 LYNFLVSGNATYTNGFL------VSIEK-IDVTNMEQRVTRDIVNGASVPTALVRGRLNL 449 L + A + + S++K +++T E V V L+ GRL L Sbjct: 671 LSKIIYPNGAEWKPEYAQVTLNPTSLKKTMEITGSEANVYYGPDYAVVVDANLIDGRLLL 730 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 285 HYVL*LRHSISNCRSHVFPTH 223 H++L S++ CR H PTH Sbjct: 401 HHLLDSSESLNTCRLHGSPTH 421 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 23.4 bits (48), Expect = 6.2 Identities = 20/69 (28%), Positives = 30/69 (43%) Frame = +3 Query: 141 QNNLVVDTRARVQHHTEYYTKLIQKLVYELEKRGFCNLKLNDVIIEHNEQLYNFLVSGNA 320 Q N+ + R Q T YY+ +Q L +EL+ G L V + + ++ N L S Sbjct: 167 QRNIPLSDTYRNQSMT-YYSSEVQSLDFELDTSGSTRLINRWVSDKTHGKIPNILPSALP 225 Query: 321 TYTNGFLVS 347 T L S Sbjct: 226 ASTTMVLAS 234 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 255 KLNDVIIEHNEQLYNFLVSGNATYTNGFLVSIEKIDVTNM 374 K ++V H E L G YT+G + + KI +TN+ Sbjct: 242 KCSEVYNTHTECLSGL---GEKGYTSGIITAAAKIALTNL 278 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,878 Number of Sequences: 2352 Number of extensions: 13607 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -