BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10c02f (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 3.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 4.4 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 4.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 5.8 AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor pr... 21 7.7 AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor pr... 21 7.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.7 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 398 NIPGDSLFHIRDIYLLYGH*KP 333 N+P + L HI + +L+Y P Sbjct: 24 NVPAEELIHIPEHWLVYPEPNP 45 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -2 Query: 421 VGTLAPFTISLVTLCSIFVTSIFSMDTRNPL 329 +G FT+ LVTL + ++ +++ R+P+ Sbjct: 299 LGKYLLFTMVLVTLSVVVTIAVLNVNFRSPV 329 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 4.4 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = +3 Query: 309 SGNATYTNGFLVSIEKIDVTNMEQRVT----RDIVNG 407 SGN T ++ I + +N E RVT +I+NG Sbjct: 12 SGNWGSTIAKIIGINAANFSNFEDRVTMYVYEEIING 48 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 296 QLPGIRKRDLH*RVSSVHREDR 361 QLPG ++ R++ ++REDR Sbjct: 373 QLPGTGRQSELLRLNGINREDR 394 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 296 QLPGIRKRDLH*RVSSVHREDR 361 QLPG ++ R++ ++REDR Sbjct: 373 QLPGTGRQSELLRLNGINREDR 394 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 450 RDVKVGFDVDAHINDELRHY 509 +DV V +D HI + +R Y Sbjct: 674 KDVDVTLPLDLHIQNAIREY 693 >AY340960-1|AAQ16586.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 7.7 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 303 LVSGNATYTNGFLVSIEKIDVTNMEQRVTRDIVNGASVPTALVRGRL-NLRDVKVGFDVD 479 LVS + T+ + +DV + + IV+GA+V L+ L N+ + + +V Sbjct: 18 LVSDVSAKTSISVKGESNVDVVSQINSLVSSIVSGANVSAVLLAQTLVNILQILIDANVF 77 Query: 480 A 482 A Sbjct: 78 A 78 >AY055108-1|AAL15544.1| 78|Apis mellifera apisimin precursor protein. Length = 78 Score = 21.4 bits (43), Expect = 7.7 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 303 LVSGNATYTNGFLVSIEKIDVTNMEQRVTRDIVNGASVPTALVRGRL-NLRDVKVGFDVD 479 LVS + T+ + +DV + + IV+GA+V L+ L N+ + + +V Sbjct: 18 LVSDVSAKTSISVKGESNVDVVSQINSLVSSIVSGANVSAVLLAQTLVNILQILIDANVF 77 Query: 480 A 482 A Sbjct: 78 A 78 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 438 RLNLRDVKVGFDVDAHINDE 497 +LN +D+ G + AHI D+ Sbjct: 155 KLNTQDIVPGVRIGAHILDD 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,841 Number of Sequences: 438 Number of extensions: 3447 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -