BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b24r (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 3.1 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 5.3 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +2 Query: 347 LSGSDFLHSVERRAG-----LEPVDLLVVQRMVELD 439 ++ S F+ V++R EP+D VVQ+M E D Sbjct: 491 VANSSFVERVKKRGFEVVYMTEPIDEYVVQQMKEFD 526 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 5.3 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -3 Query: 589 QGMLPLTFANAADYDKIKPDDKISLLGLNSLAPGKPVDCEIKHKDGSTDRIKLN 428 QG + + NA D IK + SL N PG + I D +T+++KLN Sbjct: 105 QGPVKIMLQNATDLF-IKSLE--SLKPGNQSTPGIKLSINIILSDPNTNKLKLN 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,623 Number of Sequences: 336 Number of extensions: 2296 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -