BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b21r (497 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|c... 26 3.6 SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyce... 25 4.8 SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom... 25 6.3 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 25 8.4 >SPBC1A4.09 |||pseudouridine synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 680 Score = 25.8 bits (54), Expect = 3.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 370 RLPKHAHYARTDAAKSRVWNAHAAW 296 R+P+H A +S VWN A+W Sbjct: 454 RIPRHLRSIYPHAYQSYVWNRVASW 478 >SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 432 SNQLSGCPNQIIIMQRPSQNSGYPSMP 352 SN SG P ++ PS++ PS+P Sbjct: 403 SNNFSGTPQINVVPSSPSKSQSGPSLP 429 >SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharomyces pombe|chr 1|||Manual Length = 706 Score = 25.0 bits (52), Expect = 6.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 325 IWRHLSWHSGHAWVAGI 375 ++R+ W GH+W GI Sbjct: 507 MFRNFDWFVGHSWATGI 523 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 24.6 bits (51), Expect = 8.4 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -1 Query: 380 HKIPATQA-CPLCQDRCRQIPGMECPCSLDLVSRPVKSHHR-TCHITHASCQQL 225 H I T+A CP D + CPC + +S +K H R +C +C+ + Sbjct: 430 HPISETRAHCPFATDVLTK-----CPCGKEDISFLLKGHERKSCSDPIPTCENI 478 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,079,106 Number of Sequences: 5004 Number of extensions: 42479 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -