BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b21f (537 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 1.6 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 24 2.8 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 6.5 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 6.5 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 6.5 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.0 bits (52), Expect = 1.6 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = -2 Query: 227 DLTGRETRSRLHGHSIPGIWRHLSWHSGHAWVAGIL*GTLHYDNLIWTTGQLI 69 +LTG L +I + H+S H G ++ G G+ H+ T G L+ Sbjct: 268 NLTGSPKSQNLSSPTIRSL--HISPHHGQSYGLGSSLGSAHHGGSAGTLGSLV 318 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 24.2 bits (50), Expect = 2.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 478 CNKYRSMFVYIIYYLSIAL 422 CN++ +F+Y IYY ++ L Sbjct: 5 CNEFHFLFMYNIYYRALWL 23 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/24 (29%), Positives = 11/24 (45%) Frame = +2 Query: 137 KHAHYARTDAAKSRVWNAHAAWTW 208 +H+H T+ K W H W + Sbjct: 669 RHSHINVTEHFKGNNWKVHPDWVY 692 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 175 GFGGICPGIVGMLG 134 GFGG+ P G+LG Sbjct: 43 GFGGLAPNGTGLLG 56 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 160 RCRQIPGMECPCSLDLVSRPVKSHHRTCHITHASC 264 RC ++ EC LDL+ + + +H T H+ C Sbjct: 39 RCVRV--RECGYVLDLLRKDLFAHSDTVHLEGLQC 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,225 Number of Sequences: 2352 Number of extensions: 11586 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -