SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV10b18r
         (758 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695256-1|AAW21973.1|  168|Tribolium castaneum ventral nerve co...    26   0.38 
AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cogna...    21   8.1  
AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock prote...    21   8.1  

>AY695256-1|AAW21973.1|  168|Tribolium castaneum ventral nerve cord
           defective protein protein.
          Length = 168

 Score = 25.8 bits (54), Expect = 0.38
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = -2

Query: 355 NADAFEADTRHKYTADSRQ-NIFVVQAPPQKRRKRKDTFSHAK-FEHTIRLRTQRRLT 188
           N    E D     + DS+  ++   QA   K+RKR+  FS A+ +E   R R QR L+
Sbjct: 9   NPAVSERDPDEDNSEDSKDPHLTDQQASGHKKRKRRVLFSKAQTYELERRFRQQRYLS 66


>AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cognate
           70 protein.
          Length = 196

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +3

Query: 471 RLRTKCLRSARTI 509
           RLRT+C R+ RT+
Sbjct: 90  RLRTQCERAKRTL 102


>AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock protein
           70 protein.
          Length = 196

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +3

Query: 471 RLRTKCLRSARTI 509
           RLRT+C R+ RT+
Sbjct: 90  RLRTQCERAKRTL 102


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,975
Number of Sequences: 336
Number of extensions: 3552
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20338724
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -