BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fmgV10b15r
(677 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q2GK12 Cluster: Putative uncharacterized protein; n=1; ... 33 8.4
>UniRef50_Q2GK12 Cluster: Putative uncharacterized protein; n=1;
Anaplasma phagocytophilum HZ|Rep: Putative
uncharacterized protein - Anaplasma phagocytophilum
(strain HZ)
Length = 589
Score = 32.7 bits (71), Expect = 8.4
Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
Frame = -3
Query: 558 VLVKIFDLCSVPILLMY*KYSQKFLMH--FSYIFADGNFIVINN-QVLQTFS*HLHNFLL 388
+++ F L S+ + + KY+ +L +++ GN ++N + T+S HL+NFL+
Sbjct: 42 IILSCFVLSSIICVASFIKYASNYLQDKKTAFVIEVGNSDILNELKNALTYSSHLNNFLI 101
Query: 387 PIGTVKR 367
IG +R
Sbjct: 102 SIGGEER 108
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 569,094,519
Number of Sequences: 1657284
Number of extensions: 10667558
Number of successful extensions: 19829
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18804
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19794
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52479343733
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -