BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b15r (677 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2GK12 Cluster: Putative uncharacterized protein; n=1; ... 33 8.4 >UniRef50_Q2GK12 Cluster: Putative uncharacterized protein; n=1; Anaplasma phagocytophilum HZ|Rep: Putative uncharacterized protein - Anaplasma phagocytophilum (strain HZ) Length = 589 Score = 32.7 bits (71), Expect = 8.4 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 3/67 (4%) Frame = -3 Query: 558 VLVKIFDLCSVPILLMY*KYSQKFLMH--FSYIFADGNFIVINN-QVLQTFS*HLHNFLL 388 +++ F L S+ + + KY+ +L +++ GN ++N + T+S HL+NFL+ Sbjct: 42 IILSCFVLSSIICVASFIKYASNYLQDKKTAFVIEVGNSDILNELKNALTYSSHLNNFLI 101 Query: 387 PIGTVKR 367 IG +R Sbjct: 102 SIGGEER 108 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,094,519 Number of Sequences: 1657284 Number of extensions: 10667558 Number of successful extensions: 19829 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19794 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -