BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b15r (677 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031627-17|CAA20950.2| 344|Caenorhabditis elegans Hypothetical... 28 5.3 Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical pr... 28 7.0 >AL031627-17|CAA20950.2| 344|Caenorhabditis elegans Hypothetical protein Y102A5C.28 protein. Length = 344 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 234 LQETKYRKVLFYFTIQNNK**SQSLWCVCSFVFRYPNLFIIIKSGIFC 91 + E Y LFY TI N+ S L V +V +LF++I G+ C Sbjct: 173 VDEVAYTGRLFYSTIDNSLRYSAILTGVLQWVLTASSLFLVIFFGLRC 220 >Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical protein ZK455.2 protein. Length = 1118 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 465 KCMKNASRTFENIFNTSIKLEQNISQISLLK 557 +C KN R FEN +S KL N+ ++L K Sbjct: 68 RCSKNVRRRFENEKYSSTKLYFNVRSLNLKK 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,986,887 Number of Sequences: 27780 Number of extensions: 282795 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -