BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b13r (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57300.1 68418.m07158 UbiE/COQ5 methyltransferase family prot... 98 7e-21 >At5g57300.1 68418.m07158 UbiE/COQ5 methyltransferase family protein similar to ubiquinone biosynthesis methyltransferase COQ5 [Saccharomyces cerevisiae][SP|P49017], ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Escherichia coli][SP|P27851]; contains Pfam profile PF01209: methlytransferase, UbiE/COQ5 family Length = 288 Score = 97.9 bits (233), Expect = 7e-21 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = -2 Query: 220 YDQYSFQVIPVLGQLVAGQWKPYQYLVESIRQFPNQEKFKMMIEDAGFRQVAYENLTFGT 41 YD YSFQVIP LG+L+AG + YQYLVES+R+FP QE+F MI DAGF +V YENL G Sbjct: 220 YDLYSFQVIPNLGELIAGDRESYQYLVESVRRFPPQERFASMIADAGFEKVEYENLVGGV 279 Query: 40 VAIHSGFKI 14 VAIHS K+ Sbjct: 280 VAIHSAIKL 288 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,426,152 Number of Sequences: 28952 Number of extensions: 293969 Number of successful extensions: 827 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -