BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b12f (397 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42229| Best HMM Match : Na_H_Exchanger (HMM E-Value=3.9) 31 0.26 SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) 31 0.26 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.45 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 30 0.78 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_51592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_17462| Best HMM Match : DUF1168 (HMM E-Value=0.37) 29 1.8 SB_56515| Best HMM Match : Ribosomal_L30 (HMM E-Value=5.6) 28 2.4 SB_50455| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) 28 2.4 SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 28 2.4 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_31773| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_51906| Best HMM Match : DUF1621 (HMM E-Value=0.22) 27 4.2 SB_31478| Best HMM Match : Extensin_2 (HMM E-Value=1.3) 27 5.5 SB_1235| Best HMM Match : Astacin (HMM E-Value=0.0024) 27 5.5 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_27578| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_54807| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.6 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.6 SB_40768| Best HMM Match : TM_helix (HMM E-Value=7.7) 26 9.6 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.6 SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) 26 9.6 >SB_42229| Best HMM Match : Na_H_Exchanger (HMM E-Value=3.9) Length = 678 Score = 31.5 bits (68), Expect = 0.26 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITT--LMETATNLSTTVHITWTLPKADLTSSLPLSLVL 266 P + T L T T+L L ITT L+ T + V IT TLP +T+ LPL ++ Sbjct: 272 PLVAITTILHLVTITTTLPLVVITTILLLVVITTILPLVAITTTLPLVAITTILPLVVIT 331 Query: 267 AV 272 + Sbjct: 332 TI 333 Score = 29.5 bits (63), Expect = 1.0 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVL 266 P + T T L T L L ITT++ T + V IT TLP +T+ LPL + Sbjct: 614 PLVVITTTLPLVVITTILPLVAITTILPLVAITTILPLVVITTTLPLVTITTILPLVAIT 673 Query: 267 AV 272 + Sbjct: 674 TI 675 Score = 27.5 bits (58), Expect = 4.2 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +3 Query: 114 TNLLTTARTSLILP--KITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVLAV 272 T +L + ILP ITT++ T + V IT TLP +T+ LPL ++ + Sbjct: 79 TTILPLVDITTILPLVAITTILPLVVITTILPLVVITTTLPLVAITTILPLVVITTI 135 Score = 27.5 bits (58), Expect = 4.2 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVL 266 P + T L T L L ITT++ T + V IT TLP +T+ LPL ++ Sbjct: 470 PLVAITTILPLVVITTILPLVVITTILPLVVITTILPLVVITTTLPLVAITTILPLVVIT 529 Query: 267 AV 272 + Sbjct: 530 TI 531 Score = 27.1 bits (57), Expect = 5.5 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVL 266 P + T L T L L ITT++ T + V IT TLP +T+ LPL + Sbjct: 515 PLVAITTILPLVVITTILPLVVITTILHLVAITTILPLVAITTTLPLVVITTILPLVAIT 574 Query: 267 AV 272 + Sbjct: 575 TI 576 Score = 26.2 bits (55), Expect = 9.6 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVL 266 P + T L T L L ITT++ T + V IT TLP +T+ LPL + Sbjct: 578 PLVAITTILPLVAITTVLPLVVITTILPLVVITTILPLVVITTTLPLVVITTILPLVAIT 637 Query: 267 AV 272 + Sbjct: 638 TI 639 >SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) Length = 1165 Score = 31.5 bits (68), Expect = 0.26 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVLAV 272 T T L T L L ITTL+ T + V IT TLP +T++LPL ++ + Sbjct: 541 TTTLPLVVITTILPLVTITTLLPLVVITTILPLVVITTTLPLVAITTTLPLVIITTI 597 Score = 28.7 bits (61), Expect = 1.8 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +3 Query: 99 LKETATNLLTTARTSLILPKITTLMETATNLSTTVH---ITWTLPKADLTSSLPL 254 L + + +L L ITT++ T ++TT+H IT TLP +T+ LPL Sbjct: 502 LNHASKKAILAITNTLPLVVITTILHLVT-ITTTLHLVTITTTLPLVVITTILPL 555 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 123 LTTARTSLILPKITTLMETA--TNLSTTVHITWTLPKADLTSSLPLSLVLAV 272 L T L L ITT++ T + V IT TLP +T+ LPL + + Sbjct: 645 LVVITTILPLVVITTILHLVAITTILPLVVITTTLPLVTITTILPLVAITTI 696 Score = 26.6 bits (56), Expect = 7.3 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 123 LTTARTSLILPKITTLMETATNLSTT--VHITWTLPKADLTSSLPL 254 L T T L L ITT++ +T V IT TLP +T+ LPL Sbjct: 555 LVTITTLLPLVVITTILPLVVITTTLPLVAITTTLPLVIITTILPL 600 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.7 bits (66), Expect = 0.45 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +2 Query: 113 YEPIDNRPYIVNPPKDYNPNGNG-YEPIDNGAY--YVDPPQGRPYFKPTPFP 259 Y P N PY P Y P N Y P N Y +PP P + P P P Sbjct: 116 YPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 28.3 bits (60), Expect = 2.4 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +2 Query: 113 YEPIDNRPYIVNPPKDYNPNGNG-YEPIDNGAY----YVDPPQGRPYFKPTPFP 259 Y P N PY P Y P+ N Y P N Y Y PP P P P P Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 113 YEPIDNRPYIVNPPKDYNPNGN-GYEPIDNGAYYVDPPQGRPYFKPTPFP 259 Y P N PY P Y P N Y P N Y PP + P P P Sbjct: 108 YPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY---PPSPNAPYPPPPNP 154 Score = 27.1 bits (57), Expect = 5.5 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +2 Query: 113 YEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQG-RPYFKPTP 253 Y P N PY P Y P N P Y PP P + P P Sbjct: 179 YPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 29.9 bits (64), Expect = 0.78 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +2 Query: 107 NGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFPG 262 NG P + P+ PP Y P NG +P+ Y+ P G+P + PF G Sbjct: 314 NGQPPYNTPPFNGQPPY-YTPPFNG-QPL----YHTPPFNGQPPYNTPPFNG 359 Score = 29.1 bits (62), Expect = 1.4 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Frame = +2 Query: 110 GYEPIDNRPYIVNPPKDYN-PNGNGYEPID----NG--AYYVDPPQGRPYFKPTPFPG 262 G P + P+ PP YN P NG P + NG YY P G+P + PF G Sbjct: 293 GQPPYNAPPFTGQPP--YNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHTPPFNG 348 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 28.7 bits (61), Expect = 1.8 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLVLAVGSKEY 287 T TN+ TT T++ ITT + T T ++TT IT T+ +T+++ +++ + Sbjct: 1063 TITNITTTINTTINTTIITTTI-TTTIITTT--ITTTIITTTITTTITTTIITTTVTTTI 1119 Query: 288 LRKLIT 305 + IT Sbjct: 1120 ITTTIT 1125 Score = 26.2 bits (55), Expect = 9.6 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = +3 Query: 114 TNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLVLAVGSKEYLR 293 T +TT T + + ITT + T N TT+ IT T+ +T+++ +++ + Sbjct: 1052 TITITTTTTIITITNITTTINTTIN--TTI-ITTTITTTIITTTITTTIITTTITTTITT 1108 Query: 294 KLIT 305 +IT Sbjct: 1109 TIIT 1112 >SB_51592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNLSTTVH--ITWTLPKADLTSSLPLSLV 263 T + ++TT + +I ITT+ + T L+TT+ I LP TS PL ++ Sbjct: 20 TISQIITTL-SRIITDPITTISQIITTLATTISQIIRTPLPIITTTSRTPLRII 72 >SB_17462| Best HMM Match : DUF1168 (HMM E-Value=0.37) Length = 352 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNLSTTVHITWTL 221 T TN++TTA T+ I+T+ T T +T + I T+ Sbjct: 297 TNTNIITTATTTTTSTTISTITVTITTTTTIIIIVITI 334 >SB_56515| Best HMM Match : Ribosomal_L30 (HMM E-Value=5.6) Length = 183 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 81 CWLWPTLKETATNLLTTARTSLILPKITTLMETAT 185 CW++PT+ ++A + + RT L L +I L AT Sbjct: 129 CWIFPTVGKSAEEITSILRT-LFLRRIPLLFSKAT 162 >SB_50455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +3 Query: 96 TLKETATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLV 263 T+ AT + T T++I TT+ T T ++TT+ T T +T+++ +++ Sbjct: 12 TIITNATTTIITLSTTIITTT-TTITTTTTTITTTITPTITTTTTIITTTITTTII 66 >SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) Length = 839 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 126 TTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSS 245 T A + + PK TT +ET TTV + T P + TS+ Sbjct: 229 TDAPATTLAPKTTTALETTVEAKTTV-VPETTPALETTSA 267 >SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 28.3 bits (60), Expect = 2.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 111 ATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTS 242 AT +TT ++ P TT TAT +TT T T P A T+ Sbjct: 96 ATATITTYTATVTAPNATTTTPTATTTTTTT-TTTTTPYATTTT 138 >SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +2 Query: 92 ANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPT 250 A A +GY+ DN Y + NGY DN P P +K T Sbjct: 382 AEAHVDGYQTYDNPTYDTEHETHAEAHVNGYPTYDNPTCDTHSPARAPAYKRT 434 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 28.3 bits (60), Expect = 2.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 126 TTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSS 245 T A + + PK TT +ET TTV + T P + TS+ Sbjct: 2291 TDAPATTLAPKTTTALETTVEAKTTV-VPETTPALETTSA 2329 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 126 TTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSS 245 T A + + PK TT +ET TTV + T P + TS+ Sbjct: 776 TDAPATTLAPKTTTALETTVAAKTTV-VPETTPALETTSA 814 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 27.9 bits (59), Expect = 3.2 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -1 Query: 313 HYFVINFLRYSLLPTASTRERGRLEVRSALGRVHVICT 200 HY + F R PT S R R R E A RVHV C+ Sbjct: 973 HYLKVGFERLPSPPTNSRRRRLRSE---ADARVHVTCS 1007 >SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 27.9 bits (59), Expect = 3.2 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 166 P*WKRLRTYRQRCILRGPSPRPTLLQAYPFPWCSRWEVKNILEN 297 P + L T + CI R +PT + P PW +++N+ ++ Sbjct: 560 PRLEMLNTLLRECIDRHAPLKPTKMTRPPAPWLKELDIQNLQQD 603 >SB_31773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 27.5 bits (58), Expect = 4.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 238 VRSALGRVHVICTVVDRFVAVSIRVVIFGRINDVRAVVNRFVAVS 104 VR + R VV R S+RVV+ + VR V+ R+VA++ Sbjct: 772 VRVVMRRYVTSVRVVMRRYVASVRVVMPRYVASVRVVMRRYVAIA 816 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = -1 Query: 238 VRSALGR-VHVICTVVDRFVAV-SIRVVIFGRINDVRAVVNRFVA 110 VR + R V + V+ R+VA+ S+RVV+ + VR V+ R+VA Sbjct: 794 VRVVMPRYVASVRVVMRRYVAIASVRVVMRRYVASVRVVMRRYVA 838 Score = 27.1 bits (57), Expect = 5.5 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -1 Query: 238 VRSALGRVHVICTVVDRFVAVSIRVVIFGRINDVRAVVNRFVA 110 VR + R VV R S+RVV+ + VR V+ R+VA Sbjct: 818 VRVVMRRYVASVRVVMRRYVASVRVVMRRYVTSVRVVMRRYVA 860 >SB_51906| Best HMM Match : DUF1621 (HMM E-Value=0.22) Length = 266 Score = 27.5 bits (58), Expect = 4.2 Identities = 14/53 (26%), Positives = 32/53 (60%) Frame = +3 Query: 114 TNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLVLAV 272 TN++TT+ T++I T+ T T ++ T+ IT T+ +T ++ +++ + + Sbjct: 168 TNIITTSNTNIITTTTITITITIT-ITITITITITI-TITITITITITITITI 218 >SB_31478| Best HMM Match : Extensin_2 (HMM E-Value=1.3) Length = 515 Score = 27.1 bits (57), Expect = 5.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 95 NAQGNGYEPIDNRPYIVNPPKDYNPNGNGYE--PIDNGAYYVDPP 223 N G ++P RPY P + PNG+ E P++N +PP Sbjct: 187 NHSGPPFKP-GQRPYQHGGPDQFGPNGHTEEMRPLENRGPPFEPP 230 >SB_1235| Best HMM Match : Astacin (HMM E-Value=0.0024) Length = 249 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +3 Query: 114 TNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLVLA 269 T TT + ITT T T +STT+ T T T++ +++++ Sbjct: 84 TTTTTTFSATTTTTTITTTTTTTTTISTTISTTTTTTTISTTTTTITAVIIS 135 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 96 TLKETAT-NLLTTARTSLILPKITTLME-TATNLSTTVHITWTLPKADLTS 242 T ET T +L+TTA + +TT E T +L+TT + T P+ S Sbjct: 164 TAPETTTASLVTTAPETTTASLVTTAPEATTASLATTASLATTAPETTTAS 214 Score = 27.1 bits (57), Expect = 5.5 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 87 LWPTLKETAT-NLLTTARTSLILPKITTLMETAT-NLSTTVHITWTLPKADLTSSLPLSL 260 L T ET T +L+TTA + +TT ET T +L+TT T T A +L Sbjct: 311 LLTTAPETTTASLVTTAPEATTASLVTTAPETTTASLATTAPETTTASLATTAPETTTAL 370 Query: 261 VLAVGSKEYLRKLIT 305 ++ + L T Sbjct: 371 LVTTAPETATASLAT 385 Score = 26.6 bits (56), Expect = 7.3 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 96 TLKETAT-NLLTTARTSLILPKITTLME-TATNLSTTVHITWTLPKADLTSSLPLSLVLA 269 T ET T +L TTA + +TT E T +TT + T P+A S +L++ Sbjct: 74 TAPETTTASLATTAPETTTASFLTTAPEATTAPETTTASLVTTAPEATTASLATTALLVT 133 Query: 270 VGSKEYLRKLIT 305 + L+T Sbjct: 134 TAPEATTASLVT 145 Score = 26.2 bits (55), Expect = 9.6 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETAT-NLSTTVHITWTLPKA 230 T +L+TTA + +TT ET T +L+TT T P+A Sbjct: 662 TTASLVTTAPEATTASLLTTAPETTTASLATTAPEATTAPEA 703 >SB_27578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 134 PYIVNPPKDY--NPNGNGYEPIDNGAYYVDPPQG 229 P+ ++P Y +PNG Y NG YV P G Sbjct: 8 PFSISPGVQYVFHPNGVQYVTQPNGVQYVTHPNG 41 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +2 Query: 137 YIVNPPKDY--NPNGNGYEPIDNGAYYVDPPQGRPY 238 Y+ +P Y +PNG Y NG +V P G Y Sbjct: 116 YVTHPNAQYVAHPNGAQYVTHPNGVQFVTHPNGVQY 151 >SB_54807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 26.2 bits (55), Expect = 9.6 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNL---STTVHITWTLPKADL 236 T T ++TT T++I+ ITT + T + +TT IT + A L Sbjct: 77 TTTIIITTITTTIIITTITTTIATTITIIITTTTTIITTIITTAAL 122 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 26.2 bits (55), Expect = 9.6 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 93 PTLKETATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLP 224 PT ++T TNL +T R + TT + + +TT T T+P Sbjct: 188 PTTQQTTTNLPST-RQPTTNQQTTTTLPSTKQPTTTQQTTTTIP 230 >SB_40768| Best HMM Match : TM_helix (HMM E-Value=7.7) Length = 122 Score = 26.2 bits (55), Expect = 9.6 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSLVLAV 272 T T + T T +I ITT+ T + TT+ IT T + +++ ++++ + Sbjct: 6 TITITMITTITVIITTMITTITVIITTMITTITITTTTIITTMITTIITTVIIII 60 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 26.2 bits (55), Expect = 9.6 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 119 PIDNRPYIVNPPKDYN---PNGNGYEPIDNGAYYVDPPQGR 232 P+D++P IV+ PN + + + G ++PP+G+ Sbjct: 364 PVDSQPLIVDMASSQGNQIPNSSSKQSRNEGTELINPPEGQ 404 >SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) Length = 3015 Score = 26.2 bits (55), Expect = 9.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 108 TATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSL 248 T ++ TT T+ I ITT T TT HI T+P A + +++ Sbjct: 1095 TTAHINTTITTAHINTTITTAHINTT--ITTAHINTTIPTAHINTTI 1139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,042,022 Number of Sequences: 59808 Number of extensions: 262978 Number of successful extensions: 1053 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -