BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b11f (604 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) 43 2e-04 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 37 0.011 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 35 0.058 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 33 0.13 SB_43479| Best HMM Match : GLTT (HMM E-Value=0.66) 33 0.18 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 31 0.54 SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) 31 0.95 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 31 0.95 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 31 0.95 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 31 0.95 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 31 0.95 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 30 1.3 SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 30 1.7 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 30 1.7 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 30 1.7 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 29 2.9 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 29 2.9 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 29 2.9 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 29 2.9 SB_54663| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 29 3.8 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 29 3.8 SB_32032| Best HMM Match : PAN (HMM E-Value=0.029) 28 5.1 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 28 5.1 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 28 5.1 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 28 6.7 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 28 6.7 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 28 6.7 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_42856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) 28 6.7 SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 27 8.8 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 27 8.8 SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_24680| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.7 >SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) Length = 856 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 368 QPYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFHE-PIECRICQKCMEI 523 Q + +I T K+++PL LECGHT C++CI + + + + C CQ ++ Sbjct: 390 QTFSIEISKT-KKVHIPLLLECGHTYCDSCIIKLSRLQKTQVACPECQHVTQL 441 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +2 Query: 353 CPNCSQPYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFH-EPIECRICQKCMEIDS 529 CP C Y T +P L+C HT C CI I + + +EC C+ + S Sbjct: 330 CPLCYTAY-----GTGYPQRIPRILDCSHTFCTECIMKIKELQGDVVECPTCKLRTLLTS 384 Query: 530 SESCL 544 S CL Sbjct: 385 SVDCL 389 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 34.7 bits (76), Expect = 0.058 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +2 Query: 350 CCPNCSQPYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFHEPIECRICQKC 514 CCP CS+P++ P L C HT C +C++ IV+ C KC Sbjct: 658 CCPICSRPFKS-----------PKILPCLHTYCSDCVKEIVRSRLGKLTLQCPKC 701 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +2 Query: 416 PLFL-ECGHTVCENCIRNIVKFHEP-IECRICQ 508 PL L CGH+VC C++N+ K + P + C +C+ Sbjct: 33 PLVLPSCGHSVCLQCLQNMTKRNPPSLLCPVCR 65 >SB_43479| Best HMM Match : GLTT (HMM E-Value=0.66) Length = 161 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +1 Query: 301 NLQSCKNGTHRSRNKKMLSQLQPTLSISNTFNYIKDQLTIVPGMWSHC 444 +L S + R K +S LQ T+ IS TF+YI QL + +S C Sbjct: 32 SLTSDMHEASRGLQTKQISLLQRTVHISKTFSYISQQLFSINRPFSQC 79 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/70 (27%), Positives = 35/70 (50%) Frame = +2 Query: 335 LETKKCCPNCSQPYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFHEPIECRICQKC 514 L+ + CCP C++ ++ + LP+ C H VC +C++ + I+C IC+K Sbjct: 16 LQEEICCPICTEIFE-------TPKCLPV---CAHNVCLSCLKKMKIEQGFIKCPICRKK 65 Query: 515 MEIDSSESCL 544 +I + L Sbjct: 66 TKITNPAESL 75 >SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) Length = 478 Score = 30.7 bits (66), Expect = 0.95 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 369 NLINFKYFQLYQRSTYHCSWNVVT-LFVKIVLETLSSFTNRLNAGYARNVW 518 NL Y ++Y+R C + L VK+ LE + F + L A Y R VW Sbjct: 377 NLYPIGYVKVYERG---CPIPFIPELHVKVYLENIQLFLSPLTADYVRRVW 424 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 30.7 bits (66), Expect = 0.95 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRI-CQKCME 520 P L C HT C +C+ ++V+ + EC + C +C E Sbjct: 27 PRVLACLHTYCRHCLESLVEHSK--ECTVSCPQCRE 60 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 30.7 bits (66), Expect = 0.95 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRI-CQKCME 520 P L C HT C +C+ ++V+ + EC + C +C E Sbjct: 26 PRVLACLHTYCRHCLESLVEHSK--ECTVSCPQCRE 59 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 30.7 bits (66), Expect = 0.95 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +2 Query: 317 KMEPIDLETKKCCPNCSQPYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFHEPIEC 496 K P + E K CP C + +S + + ECGH +C++C + I + EP +C Sbjct: 44 KKPPFE-ERKHLCPVCEDIF-------VSPVQIK---ECGHRLCQHCYKTIWRSPEP-KC 91 Query: 497 RIC 505 C Sbjct: 92 PKC 94 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 30.7 bits (66), Expect = 0.95 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRI-CQKCME 520 P L C HT C +C+ ++V+ + EC + C +C E Sbjct: 36 PRVLACLHTYCRHCLESLVEHSK--ECTVSCPQCRE 69 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 30.7 bits (66), Expect = 0.95 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIE 493 P+ L CGHT+C+ C+ + K P + Sbjct: 28 PISLACGHTICKACLSQLHKTQCPFD 53 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 431 CGHTVCENCIRNIVKFHEP--IECRICQKCMEI 523 C H VC C+ I K + +EC IC+ EI Sbjct: 38 CAHNVCRECLEKITKRNSIRFVECPICRARSEI 70 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 350 CCPNCSQPYQFQILSTISKINLPLFLECGHTVCENCI 460 CC C P+ +T S+ +P L CGHT C C+ Sbjct: 140 CCSVCYNPFH----ATESQA-IPRNLNCGHTYCTGCL 171 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 416 PLFLECGHTVCENCI 460 P L CGHTVCE C+ Sbjct: 111 PCTLPCGHTVCEKCL 125 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHE-PIECRICQKCMEIDSSE 535 P L C H++C+ C+++I + E I C +C +E E Sbjct: 31 PRLLPCLHSLCKKCLKDIEQAQEGAIACPVCLTDVECHLEE 71 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 410 NLPLFLECGHTVCENCIRNIVKFHEPI-ECRICQ 508 N P L C H+ C+NC+ ++ E + C CQ Sbjct: 25 NNPKVLPCLHSFCQNCLDKSIRSQERVLVCPTCQ 58 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRICQKCME 520 P L C HT C +C+ ++V+ H C +C E Sbjct: 27 PRVLACLHTYCRHCLESLVE-HSQERTVSCPQCRE 60 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRICQKCME 520 P L C HT C +C+ ++V+ H C +C E Sbjct: 27 PRVLACLHTYCRHCLESLVE-HSQERTVSCPQCRE 60 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 425 LECGHTVCENCIRNIVKFHEPI--ECRICQKCMEIDS 529 L C HT C CI +I+ + + C C + + +DS Sbjct: 158 LPCLHTYCRRCIEDIILHRQSVRAHCPSCNREIPLDS 194 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = +2 Query: 332 DLETKKCCPNCSQ-PYQFQILSTISKINLPLFLECGHTVCENCIRNIVKFHEPIECRICQ 508 D E ++ N + YQ + + + P+ L CGH C CI+ + +C IC+ Sbjct: 52 DTEEEEVLQNIFELDYQPDCPVCLQQASYPVRLPCGHMFCFLCIKGVAL--RSRKCAICR 109 Query: 509 KCMEIDSSESCLLV 550 + + D + LV Sbjct: 110 QPISPDYLDKPTLV 123 >SB_54663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = +2 Query: 344 KKCCPNCSQPYQFQILSTISKINLPLFLECGHTVCENCIRNI 469 ++ CP C+ P + + +++ + CG+ C C+R+I Sbjct: 247 RRLCPRCTSPSNYTQVQNVAQC---ICERCGNEFCPYCLRDI 285 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 431 CGHTVCENCIRNIVKFHEP--IECRICQKCMEI 523 C H VC C+ I + +EC IC+ EI Sbjct: 38 CAHNVCRECLEKITARNSSRFVECPICRARSEI 70 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/48 (25%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +2 Query: 431 CGHTVCENCIRNIVKFHE-PIECRI--CQKCM---EIDSSESCLLVXE 556 CGH C C+ N+++ + P+ C C + ++D+ + C +V + Sbjct: 1967 CGHVYCRGCVTNLIEAKQFPLTCAYEDCSTLLAIHDVDNLKECDIVND 2014 >SB_32032| Best HMM Match : PAN (HMM E-Value=0.029) Length = 610 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = -2 Query: 351 HFFVSRSMGSIFTTLKILAITLDYFKGNI--LRIVNKSISLCFI*LNRNVC 205 +FFV++S TL + + DYFKG I L+I N ++ I L +++C Sbjct: 121 NFFVAKSDNKRPITLGANSRSTDYFKGRIACLQIYNSELTGTEIELVKHIC 171 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 404 KINLPLFLECGHTVCENCIRNIVKFHEPIEC--RICQKC 514 + N P L C H+ C++CI + + E +C IC C Sbjct: 68 RFNKPKLLHCLHSFCQSCIEGLARKTED-DCLELICPVC 105 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 307 QSCKNGTHRSRNKKMLSQLQPTLSISNTFNYIKDQLTIVPGM 432 + C+ +SRN + LS PT+ S T + IK LTI G+ Sbjct: 93 KECEEQLKKSRNPENLSDSLPTMYSSVTVSVIKKFLTIKFGI 134 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +2 Query: 407 INLPLFLECGHTVCENCIRNIVKFHE---PIECRICQKCMEI 523 +N P+ L C ++C +C + + H + CR+C + I Sbjct: 34 MNGPVLLPCLDSICRSCCQKTAQKHGDTWTVPCRLCDSLVRI 75 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEPIECRICQKCME 520 P L C HT C +C+ ++ + H + C +C E Sbjct: 26 PRVLACLHTYCRHCLESLAE-HSQGDSISCPQCRE 59 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +2 Query: 407 INLPLFLECGHTVCENCIRNIVKFHE---PIECRICQKCMEI 523 +N P+ L C ++C +C + + H + CR+C + I Sbjct: 34 MNGPVLLPCLDSICRSCCQKTAQKHGDTWTVPCRLCDSLVRI 75 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIVKFHEP-----IECRICQKCMEIDSSE 535 P+ L C H+ C C++ ++ H+ ++C C+ MEI +S+ Sbjct: 30 PMLLRCYHSFCLRCVQELL--HQSGEKGVVKCPQCRTEMEIPNSD 72 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 428 ECGHTVCENCIRNIVKFH--EPIECRICQKCMEI 523 +C H +C C+ I++ E EC IC+ + + Sbjct: 40 KCAHNICRECLLGIIEKAQLERFECPICRAIVAV 73 >SB_42856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 357 GQHFFVSRSMGSIFTTLKILAITLDY 280 GQ+FF+ + +IF TL I+ + LDY Sbjct: 20 GQYFFLYAWLFTIFITLVIVTVYLDY 45 >SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) Length = 3616 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 372 LIN-FKYFQLYQRSTYHCSWNVVTLFVKIVLETLSSFTNRLNAGYARNVWKLIH 530 LIN + Y R Y+ S + LFVK+ + +++ N + +NVW+ H Sbjct: 377 LINAIRMINSYSRY-YNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTH 429 >SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 606 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 338 ETKKCCPNCSQPYQFQILSTISKINLPLFLECGHTVCENC 457 + + C +C Q YQ ++ T + NL E H VC+ C Sbjct: 197 DARFCSYDCKQDYQIRVSGTSVRRNL---FEAEHGVCQLC 233 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 416 PLFLECGHTVCENCIRNIV 472 P L C HT C+ C+ N+V Sbjct: 155 PRLLPCLHTFCKRCLENLV 173 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 27.5 bits (58), Expect = 8.8 Identities = 24/87 (27%), Positives = 35/87 (40%) Frame = +2 Query: 275 LK*SKVIAKIFKVVKMEPIDLETKKCCPNCSQPYQFQILSTISKINLPLFLECGHTVCEN 454 LK + +I I V+ + D + K C +C Q + N EC H VCE Sbjct: 191 LKVNFMINSILSVLLLTSEDSKKKPACESCDSGEPAQ-----GRCN-----ECDHFVCEQ 240 Query: 455 CIRNIVKFHEPIECRICQKCMEIDSSE 535 CI +F P++ EI S + Sbjct: 241 CISTHKRF-RPVQHHTILSLDEIKSGK 266 >SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1511 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 431 CGHTVCENCIRNI--VKFHEPIECRICQKCMEI 523 CG C C N +++ + CR+C+ C EI Sbjct: 1322 CGGIYCNACSHNKAPLEYRDGKLCRVCRSCREI 1354 >SB_24680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 616 Score = 25.0 bits (52), Expect(2) = 9.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 455 CIRNIVKFHEPIECRICQKCMEIDSSESCL 544 C+ ++++ P+E RIC C S L Sbjct: 224 CMFKVLEWFNPVESRICIDCSAYSESTKLL 253 Score = 20.6 bits (41), Expect(2) = 9.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 428 ECGHTVCENCI 460 +C H VC +CI Sbjct: 197 DCVHIVCADCI 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,273,967 Number of Sequences: 59808 Number of extensions: 342466 Number of successful extensions: 877 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -